SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219852286|ref|YP_002466718.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219852286|ref|YP_002466718.1|
Domain Number 1 Region: 103-296,430-566
Classification Level Classification E-value
Superfamily Subtilisin-like 1.57e-45
Family Subtilases 0.0033
Further Details:      
 
Domain Number 2 Region: 568-841
Classification Level Classification E-value
Superfamily Pectin lyase-like 4.1e-29
Family Galacturonase 0.022
Further Details:      
 
Domain Number 3 Region: 890-980
Classification Level Classification E-value
Superfamily PKD domain 4.58e-26
Family PKD domain 0.00056
Further Details:      
 
Weak hits

Sequence:  gi|219852286|ref|YP_002466718.1|
Domain Number - Region: 1005-1055
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000124
Family Type I dockerin domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219852286|ref|YP_002466718.1|
Sequence length 1056
Comment periplasmic copper-binding protein [Methanosphaerula palustris E1-9c]
Sequence
MRHSLLLSGTIILLFCLIIIPTEALVQSESAVRPTMFAWEEKMSSDLLPLVDERFLSPGE
TQGEAAKGTVRQTGINGTLNDEVFIYIRVTETISVKDLDRWCVEITDRDDGEHRVAAWVR
VSDLPSLASLEWIRSIQTVLPPIVNTGSVDTQGDQIIRADQIRRTTGSSGQGVKVGVIST
GVDHWRDAAATGDLPSTLHVLSNSFGGDEGTAMLEIIHDIAPDADLYFYDTGTNTIAFNR
AVDALTEAGCSVIVDDISWLGEPFFEDGSVATHIQEKIQNGNLVYVTSAGNYAQKHYQGT
YFNDGSGWHDFSAGSSSRKKIYLSIPPGGSVRAVLQWDDPFGTSANDYDLYLNEQYPYSG
ITLKKSTNAQTGSADPIEWITYTNSNSYTINAELDVNNYMNLAEERTLELQMYISSGTTI
SPDNLVSADSISGQAAVPEVLTIGALGATTPNQLEPFSSQGPVTIVYPHRETRQKPDLCG
IDGVAVTGAGGFPTRFYGTSAAAPHIAGVAALLWSLNPSLTPDQIRTVLIEGAVDLGDPG
WDTLYGSGRADALASKDLIRTDGKITVSGPVVIDKPGTYVLDRDIIDCQNTVGIEIKASN
VVFDGQGHLISGQNRGGSAGIFVSKDPDNPLTGVIIKNVDVDHWDYGIYYLNAIEGMIQT
IRTTGNDKYGIVLYAGSSGNTVADSTLTDNGDGIYLTASSDRNTIQNTSIRENRNHGISI
YDSTSNLLEGNSITGATAVGVQFFTTNNNTLTSSTITGDTLYGVQIYHSDGNILKNNTIT
GSTSAGVYLNQSQENSIYNNYFNNPNNALVEGTTSQNTWNHDPMLGTNIVRGPSIGGNYW
ATPSRNGFSETHPDNNRDGFCDEGYIITSEQKGKNIDEAPLILPQSSNMTRPTAGFWAIP
TKGTAPLSVQFTDTSTGIPARWTWDFGDGQNSTDQMTEVVNRTIQNPVHSYTQPGTYSVT
LTVSNPLGDDSMERTGYIIVSGSVIPIQSTNVIPKDLNGDGKYEDLNGNGRPDFEDVVLF
FDQMDWIEQYEPIDAFDFNNNNAIDFNDIVVLFNQL
Download sequence
Identical sequences B8GJF4
gi|219852286|ref|YP_002466718.1| 521011.Mpal_1686 WP_012618314.1.75456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]