SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219852354|ref|YP_002466786.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219852354|ref|YP_002466786.1|
Domain Number 1 Region: 372-513
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.56e-25
Family Family 6 carbohydrate binding module, CBM6 0.003
Further Details:      
 
Domain Number 2 Region: 791-930
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.78e-23
Family Family 6 carbohydrate binding module, CBM6 0.0071
Further Details:      
 
Domain Number 3 Region: 603-742
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.07e-21
Family Family 6 carbohydrate binding module, CBM6 0.0038
Further Details:      
 
Domain Number 4 Region: 106-332
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.86e-20
Family Papain-like 0.0044
Further Details:      
 
Weak hits

Sequence:  gi|219852354|ref|YP_002466786.1|
Domain Number - Region: 531-592
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00275
Family Rhamnogalacturonase B, RhgB, middle domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|219852354|ref|YP_002466786.1|
Sequence length 930
Comment carbohydrate binding family 6 [Methanosphaerula palustris E1-9c]
Sequence
MNRGFGRWYNWILGCMIILLLLVMVMGGASAQEVYAGVGISGVSNNSSSAVQLPVMHQND
STLKHQIDQYETAPTVSLDTAGVLKARLGLSRSQNLLPYLDYNAIQRDQNPTGNCWVWVG
TGLMEITHQVEDAIRDPLSIQYFDSTYHGGAGLTWAGNGGTLADFVNFYQQQKIAVPASN
TNASFKDNTYWCNDNNQAWVKASDIATDPHYSIASIQEQKIPTRSIGTEAAIANIKTVLD
SNKGVYFAFRLPNEQAWNDFNKFWLEGNQSAVWNPDLYDGNPWESWSGGSHAVLCVGYQD
TDPANRYWIMLNSWGNAFGNRPSGLFRVKMDIDYDAMFTSSMSIPATEWETIDMNYSPSP
QSTSIEKPYTTHTVPCRVEAEDYDYGGENISYYDTTSGNSGKVYRNDDVDIEQTTQAGGF
DVGWVRNGEWLQYTLDVPEAGDYEMRIRSSSPGAGDQIVVSVDGIDAGTLIIPQTDSFDN
YTNVSLPVKFSAGRHLVRLTFAGDRQNIDYFEINPAIPAEQGVIDGKISLGSTPSGATVF
LDNVLAGMTPLTIPSLRPGSHHLDIAKSGYQTQQLTTVIKSGETQQMNVTLLRSYPAPYV
NHTLPALIEAEDYNLGGEGIAYHDTTAWNEGSVYRNDGVDIEQIHPTGGYKVCWIRDGEW
LTYTVTIPQAGNYTVIFTGCSITPESSCTLSIDDTTLTTVSLPDTGSSDRFGTVQRMVSL
PAGVHLLKLSFIGRQDVDNLQFVAAGLQPQVSSTTVATPAPILETPTVSPSETFIVRPTP
SVTFGQFQSLPGQIQAEDFDTGGEMVAYHDTTSENLGESYRDEGVDIIFNPVDGSNSVTD
IEPGEWIRYPVNITESGVYNASFRVAANVSGSTVDILIDDSNLSAVQVPDTGSLSSFTWI
TRQIWLPAGQHMLRLKFSGPLSIDTMKFTP
Download sequence
Identical sequences B8GJZ2
521011.Mpal_1756 gi|219852354|ref|YP_002466786.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]