SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219852362|ref|YP_002466794.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219852362|ref|YP_002466794.1|
Domain Number 1 Region: 794-878
Classification Level Classification E-value
Superfamily PKD domain 3.92e-25
Family PKD domain 0.00046
Further Details:      
 
Domain Number 2 Region: 468-552
Classification Level Classification E-value
Superfamily PKD domain 4.71e-24
Family PKD domain 0.00039
Further Details:      
 
Domain Number 3 Region: 636-711
Classification Level Classification E-value
Superfamily PKD domain 2.49e-22
Family PKD domain 0.00043
Further Details:      
 
Domain Number 4 Region: 555-634
Classification Level Classification E-value
Superfamily PKD domain 3.79e-21
Family PKD domain 0.00066
Further Details:      
 
Domain Number 5 Region: 715-794
Classification Level Classification E-value
Superfamily PKD domain 5.49e-21
Family PKD domain 0.0013
Further Details:      
 
Domain Number 6 Region: 22-294
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000000162
Family Pectin methylesterase 0.053
Further Details:      
 
Domain Number 7 Region: 904-958
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000001
Family Type I dockerin domain 0.0065
Further Details:      
 
Domain Number 8 Region: 251-491
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000942
Family Galacturonase 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|219852362|ref|YP_002466794.1|
Sequence length 958
Comment PKD domain-containing protein [Methanosphaerula palustris E1-9c]
Sequence
MMDGKETRCGGRAGFFVALGCIVLLLLLIGPVTAQTVTVAASDSSAASKAAANYICDGYN
DQVEINAAFNALPGEVGTVQLTEGTFHCSDVIFPTAGSELLGSGQDSTVIEMLNPLNSYI
SISVKYSGITLRGFTLRGQGAVTIRASQVIVQDVTATSIGLDGKRYSTKNDGMFYLWGDG
STIEDVIFINCKAVDSVTHGFHLNAINLPKETRNIRFISCQAIRCGFGVSGGSPSEWITG
YDLQEDNDLYDVQLIDCLAEDNWESGFHFEPGEDKTPPTVKKGIIMTDCVSRDNGQRNPQ
QFPYHDTFLSGYFVHFNAVLTNCISENNKNAGYFVQGGNNVVFNGCTDTGSTYGWKIVKA
ASDITLNNCTTSDNLFWGLWSAFADHIVLNHFSQNNIGGNLNYQSMLGWYYDEEAYQYPV
TDSSFNITAYGNNTSLPIINQEGQGNTYSLSWGSNDSRNVTPTVNVTPTQPATHSPVAQF
QATPLTGSAPLSVSFTDLSTGSPANWSWNFGDGSTSTLQNPQHQYLEDGIETVTLTVSNS
FGSSNTTKIITVGEGVYAGFTATPRTITAGQTIQFTDHSSGAPSGWIWNFGDGSVSASQN
PQHLYGVTGVYSVQLTASFPGSSDHETKTDYIVADPDFSVDATTGIAPTTIRFTDTTPNG
QTAWQWDFGDGTTSKEENPVHLYQNGGNYTVTLTATSPYGTTSVTKDAYIHLAGKPVAAF
TSTPQVGTVPFDVSFTDMSTGGTAVGYYWQFGDGNFSTLQNPVHTYTHEGVYTVQMIVFN
QYGVSNTSKIACVVANLPSPIADFSAGSTEGTAPFQVQFSDRSLNQPSNWFWQFGDGATS
TAQNPVHNYTTAGTYTVSLMVRNSGGVMTVTKTNYITVTSPVVSGVVRVYGQTAMPTDPN
HDGLYEDLNGNGVIDFNDVVLFFNQMDWIAENEPLAAFDFNHNGQIDFNDIVQLFNML
Download sequence
Identical sequences B8GK00
521011.Mpal_1764 gi|219852362|ref|YP_002466794.1| WP_012618390.1.75456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]