SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219852382|ref|YP_002466814.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219852382|ref|YP_002466814.1|
Domain Number 1 Region: 911-1011
Classification Level Classification E-value
Superfamily PKD domain 6.02e-30
Family PKD domain 0.00029
Further Details:      
 
Domain Number 2 Region: 382-492
Classification Level Classification E-value
Superfamily PKD domain 9.16e-30
Family PKD domain 0.00025
Further Details:      
 
Domain Number 3 Region: 1104-1185
Classification Level Classification E-value
Superfamily PKD domain 7.72e-29
Family PKD domain 0.00027
Further Details:      
 
Domain Number 4 Region: 497-578
Classification Level Classification E-value
Superfamily PKD domain 1.83e-28
Family PKD domain 0.00036
Further Details:      
 
Domain Number 5 Region: 1016-1098
Classification Level Classification E-value
Superfamily PKD domain 1.14e-27
Family PKD domain 0.00031
Further Details:      
 
Domain Number 6 Region: 14-312
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.75e-26
Family Pectin methylesterase 0.071
Further Details:      
 
Domain Number 7 Region: 1587-1731
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.82e-26
Family Family 6 carbohydrate binding module, CBM6 0.0029
Further Details:      
 
Domain Number 8 Region: 585-669
Classification Level Classification E-value
Superfamily PKD domain 4.84e-25
Family PKD domain 0.00029
Further Details:      
 
Domain Number 9 Region: 1234-1320
Classification Level Classification E-value
Superfamily PKD domain 9.81e-23
Family PKD domain 0.00052
Further Details:      
 
Domain Number 10 Region: 1374-1450
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000000288
Family PKD domain 0.0011
Further Details:      
 
Domain Number 11 Region: 1455-1561
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000445
Family PKD domain 0.0017
Further Details:      
 
Domain Number 12 Region: 327-406
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.000000000863
Family Invasin/intimin cell-adhesion fragments 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|219852382|ref|YP_002466814.1|
Sequence length 1732
Comment carbohydrate binding family 6 [Methanosphaerula palustris E1-9c]
Sequence
MIQSKRFDLILIMILLASVLLLAPVTASSVTVGASGCDFTTLTDAINSASVVDGDTIYVY
NGTYSFTGLTKAITLTGEGADLVTLNLGGSGSTIRGSGTIIEQMRFTNGRIQLTGAAPIA
QNMIIRQCIFEGLTFNGPSYYSAIQLLGTNNTFQDNAFRNNVAPIVIYFGTGSGNRLLNN
TFVNTAPASMLNRGVISITVPATSAVIENNTFKDNTISCIQLGSTMGTGNVIDRNNFIVP
NGVSPILGTGTIPIASWVTSAAVPYTYQGSSHIGILGNYWSTYSGTDANGDGIGDTSYNT
GVSNQIDSAPLMDQAQFYFGASHSATASVSVIPASATVNVSETKQFAGKATDSDGLNIPG
LNYTWSSSNETVGTISQSGLFTALTPGSANITASNGGISNTSVVTVLSALSQPVADFTAN
VTNGTAPLSVQFTDASTGSPTGWSWDFGDGNTSTTQNPAYTYATAGNYTVNLTATNAGGS
NTTVKMNYITVTESETPMAPVAGFTANVTNGTAPLAVGFTDQSTGTPTSWSWNFGDGNTS
IEQSPAHTYATAGNYTVNLTATNAGGNNTTTKTNYITVTTAVTPVPVANFSANITNGTAP
LAVQFNDTSLGENLTAWSWAFGDGNTSLEQNPIYNYTTAGSYTVNLTVTNATGSDNEVKT
SYITVSAPVIPTPTITVAPLSAIRHIFINTANGVKYNYDGATYGGPNNTYYVKADGGGLN
ELHLTNDANVASGQVTTTGAQNGTFYVTNTGGRGFDDDIILLVSVKGPIPDNFGIHLTSN
GYVWTPAAAGAYNPTAPTDSSYVTGIDQTFSKADFIYGPQTWKPGPHQGSADLVTPYLPL
YTGQDINDASTAQYLMFVDLKAGNVKQGVIPSATLNNGALKVDYSITNLSTRADFNGFAW
ANASNQGQGITWTNNVFNPGASGYSVTAPVAAPVAGFNASVTNGTAPLAVQFNDLSTGTP
TSWSWDFGDGNTSTTQSPSHTYTVAGNYTVNLTATNAGGSNTTTKTNYITVTASESPSAP
VANFNANVTNGTAPLTVGFTDASTGAPTSWSWSFGDGNTSTTQSPSHTYTVAGNYTVNLT
ATNASGSNTSVRTNYITVTGSETPTAPVANFNANITNGTAPLAVQFTDLSTGAPVTWSWD
FGDGNTSTVQNPAYTYAAAGNYTVNLTATNAGGSNTTTKTNYITIHAVVPPTTAPTTTAP
TTVPTTIPTTIATTIPTTVPTKIPTTVPTTIPVTPTPTMQPVTANFTANVTAGQTPLSVQ
FTDLSTGTIRQYFWQFGDGGASFDKNPVHTYSAAGTYTVSLVAIGSTGAEVKTIPQYITV
TGPGTPTVSPTVTTTVTTTTPAPTTTTTITPTVTTTIPVTTTVTPLPTSSGHDLPIANFV
VTYQAGAGSMGIQVTDATTNATTVKYDLGDGTTTAYKNFKYTYWQPGTYTITLIATNDAG
SSTKTVTVTVPAGSPTTMTVTPTPTATVSPTITPTQTPTNPNLPVANFTITFQGGSGSMG
IQVTNTAVNATSVHYNLGDGTTTAYPNFTYTYWQPGNYTINQTATNAAGSTTRTINVTVP
AVATPTTIPTTTVSPTVTGTVPAYNGTHTIPGQLQAEDYDLGGEGIAYHDTTAGNEGGVY
RHDDVDIEQIDTDRSPSVGWTRAGEWLAYTVNINTAGTYTAGFRVASAHAGSSVQVYLDD
GTTPIATVNVPNTGNDATFQTLQVPVTLPAGQHRLKLAFPGNYANINWINFA
Download sequence
Identical sequences B8GK20
521011.Mpal_1784 gi|219852382|ref|YP_002466814.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]