SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219852392|ref|YP_002466824.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219852392|ref|YP_002466824.1|
Domain Number 1 Region: 310-358
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000001
Family Type I dockerin domain 0.0072
Further Details:      
 
Weak hits

Sequence:  gi|219852392|ref|YP_002466824.1|
Domain Number - Region: 55-158,204-240
Classification Level Classification E-value
Superfamily Sialidases 0.00824
Family Sialidases (neuraminidases) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219852392|ref|YP_002466824.1|
Sequence length 361
Comment hypothetical protein Mpal_1795 [Methanosphaerula palustris E1-9c]
Sequence
MQRRDENGHGWYRQKTQPPKRRGGGLALLLFLGILLFIPPGGAAPIADYNNVMIHVANPE
GPAYNVFGNGSYLSRFEGVDRGLNALHISTDPAVNFGQVTTTANQSGTFYATDSGGKGYE
DDILLLVAVNGTIPDDFKLHVTADGYTWTPNPISNTAPTSSTYNATTLDETFTKADLIYG
PQNWKPTGNGYSYPIYYGQDTNDTTNTFQVMLIDLNAGVLRPNAALENQGAVRIHYSFEN
LSSFAAFNVYGYCKTSNNGFDMIAWTNSLMPDRTPSGYSVTASSPVLKILPLPDQQHAPL
DHDGDGRYEDLNGNGQADFSDVVLFFNQMDWIAENEPVDAFDFNKNGKIDFGDVVSLFIR
I
Download sequence
Identical sequences B8GK30
gi|219852392|ref|YP_002466824.1| 521011.Mpal_1795 WP_012618420.1.75456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]