SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219852407|ref|YP_002466839.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219852407|ref|YP_002466839.1|
Domain Number 1 Region: 2480-2567
Classification Level Classification E-value
Superfamily PKD domain 1.57e-30
Family PKD domain 0.00027
Further Details:      
 
Domain Number 2 Region: 2567-2652
Classification Level Classification E-value
Superfamily PKD domain 5.1e-29
Family PKD domain 0.00035
Further Details:      
 
Domain Number 3 Region: 2144-2229
Classification Level Classification E-value
Superfamily PKD domain 7.19e-29
Family PKD domain 0.00032
Further Details:      
 
Domain Number 4 Region: 1150-1236
Classification Level Classification E-value
Superfamily PKD domain 1.83e-28
Family PKD domain 0.00027
Further Details:      
 
Domain Number 5 Region: 2657-2739
Classification Level Classification E-value
Superfamily PKD domain 9.55e-28
Family PKD domain 0.00029
Further Details:      
 
Domain Number 6 Region: 1629-1715
Classification Level Classification E-value
Superfamily PKD domain 6.54e-27
Family PKD domain 0.0004
Further Details:      
 
Domain Number 7 Region: 2051-2144
Classification Level Classification E-value
Superfamily PKD domain 1.12e-26
Family PKD domain 0.00031
Further Details:      
 
Domain Number 8 Region: 1721-1801
Classification Level Classification E-value
Superfamily PKD domain 4.84e-25
Family PKD domain 0.00033
Further Details:      
 
Domain Number 9 Region: 729-812
Classification Level Classification E-value
Superfamily PKD domain 4.97e-25
Family PKD domain 0.00059
Further Details:      
 
Domain Number 10 Region: 817-902
Classification Level Classification E-value
Superfamily PKD domain 1.31e-24
Family PKD domain 0.00028
Further Details:      
 
Domain Number 11 Region: 1242-1325
Classification Level Classification E-value
Superfamily PKD domain 1.57e-24
Family PKD domain 0.00024
Further Details:      
 
Domain Number 12 Region: 3150-3294
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.54e-24
Family Family 6 carbohydrate binding module, CBM6 0.0019
Further Details:      
 
Domain Number 13 Region: 2802-2888
Classification Level Classification E-value
Superfamily PKD domain 2.49e-22
Family PKD domain 0.00054
Further Details:      
 
Domain Number 14 Region: 1325-1626
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.37e-20
Family Pectin methylesterase 0.06
Further Details:      
 
Domain Number 15 Region: 2937-3013
Classification Level Classification E-value
Superfamily PKD domain 0.000000000000157
Family PKD domain 0.0011
Further Details:      
 
Domain Number 16 Region: 3046-3123
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000275
Family PKD domain 0.0013
Further Details:      
 
Domain Number 17 Region: 534-697
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0000222
Family Serum paraoxonase/arylesterase 1, PON1 0.098
Further Details:      
 
Weak hits

Sequence:  gi|219852407|ref|YP_002466839.1|
Domain Number - Region: 168-200,236-503
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00203
Family Serum paraoxonase/arylesterase 1, PON1 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|219852407|ref|YP_002466839.1|
Sequence length 3295
Comment carbohydrate binding family 6 [Methanosphaerula palustris E1-9c]
Sequence
MISFHKPGEFLLILIIFIAALATPALAGLVLPTNTTVDSATVQAQTLSLPLSFIENHGQA
ADAVKYQVYADGHSLAFEPDRIVLTTSQVVNNTTQRSNVTMTFPGASTSPGITGTEPLPG
KASFFLGSDSSKWQSDLPTYRSIRYQQLYPGIDLRYNGTEGVLKREFAVAAGADLNRIAI
AYDGIDGLALTADGSLLINTSLGALTDQAPVAYQEIDGVKVPVNASYRLKDDSTVGFAVG
KYDCSRPLIIDPTLLYSSYFGGSNMDCINRVRLDAAGNIYIAGYTLSTDIPLQNANQGSE
SGGSDAFVTELNPEGTAVLYSTYYGGSGNENAQGLSVDGAGNIYICGGTTSATDLPLQSP
FQTAKNGTAAGFVAKIKPSNPPGSQLVFSTYLGSLDSNPGTASTTNTTGAISIVADQSGG
AWVSGYTDCTNFPVTADAAQNKTGGWDDAYLARFASDGSLSYATYLGGSLNEGDSYLDSS
SSTKCSMGLALDAAGNVYMGGYTKSLASANNFPITAGVFQPICGGNSGATASKYDGFVAK
YTSSGSEVYVSYLGGSAADKIYDLAVDAAGAVYVTGFTNSLTAAYGWAGSGSVFLTKIDP
SFVSLDYSTKFGGTGSSNPYGITVDGSGDAYVTGYSTSNDFTIMNGTAGATNSGRGFAVK
YSPAGTMLYSTCIGLADSTTYFYGIAVNDAGDAVVGGMTQASNYPLTNSALQTTNRAITP
YFDTGALSILTNKAVAGFTATPISGNAPLSVQFNDTSAGSPMDWSWDFGDTTTSTEQNPI
KNYTSPGIYSVNLTVSNSLGSTHLLKTNYITVLDRPVMPVANFSANVTTGTTPLAVQFND
TSLGENLTNWSWAFGDGNTSTEQNPVNNYTAAGTYTVNLTVTNATGSDNTVKTNFITVTA
PLTPTPTVTPAPGGVLPDYTGIYVRAANDGGIRWDTAGNGTYYINNNGGGLNAVHISTDP
AVNAGQVTVSPAQSGTFYVTDSGGRGYQDEAVLMLAVNGTLPDDFAVRIKTSGYTWTPSS
AAPSSDAYTYQATALDETFNKSDFVYGPQNWKPSGSNSLYPIFYGEDMASSDNQFSLAFI
DTRAGLIGSKYTGYASLMNEGAVKVEYTFTNLTDSAAFNIYGWNNNAGGTGKSGMGWTNA
LTGLTASGYSVTAIPPAPVAGFTANITNGTAPLSVGFTDASTGSPMNWSWSFGDGNTSIE
QNPSHTYASTGNYTVNLTATNAGGSNTSVKTNYITVTGSGTPMAPVAGFTANVTSGSLPL
TVQFTDASTGSPTAWSWDFNNDGTVDATTQNPTFTYPKHGVYSVNLTVTNSDGTNTTIKS
NYITVSGATTWTVGASGCDFTTLMDAMNSASVVDGDTVYVYNGTYIFPSTFSKSIILSGE
DANSVTFDLNGNPATLTGTGTIIENVRFTNGLMSFPSQDLNNNFPAKDMIIRNCIFELMK
VGWSGSRTTASDITLSGTNNTFSGNIFRNNAVYSLIYMTKGVNIVENNTFTNTNSPLYKG
ALVNRGVITIDNFATGSIIRNNSFSNNNIPSLELYGGGKPGAVYLNRFTAPAGINPIIML
GIGPSQFPWSTPTAVLYTYQNKQYTGVLGNYYSTYTGVDANGDGIGDTPYSMGYNQVDPA
PLMAPVESYSPILPMPLAANFTSDVTTGTAPLSVGFTDQSTGSPTNWSWSFGDGNTSTVQ
NPVYTYAAAGNYTVNLTATNAGGSNTTTKTNYITVTGSETPTAPVANFNANVTNGAAPLS
VGFTDLSTGSPTNWSWSFGDGNTATVQNPSHTYTAIGNYTVSLNVSNSDDYNISTKTDFI
DVLNTNSAPLSNYRGINIRVANDEGVKYDVPGGVVASNTDGITYTYVPNTYFVNFRQNNG
GLNPMHISSASNAWTAADITRTASQTGSFWITFSGGQKTAADGILMLAVNGSIPDDFKVH
IRSSGNDFDPGTPGITNQDLPAVSTHLDGAVNQTFTKNDFVYGPQSWKPAGQPDYPIFGG
EDQSDPANQYHLMFVDLRVGALQNASVPDNGMIKVDYEFTNLSSTAVFNTYGWFMQSNHG
TGTIMTNDVTTSSYQVLGAPALTAPTANFTANVTNGTAPLSVGFTDASTGSPTNWSWNFG
DGNTSTVQNPVYTYSVAGNYTVNLTATNAGGSNTTTKTNYITVTTPMTPAPVSNFSANIT
NGTAPLSVGFTDLSTGAPVTWSWNFGDGNTSTLQNPSHTYAAAGNYTVNLTATNAGGSNT
TTKTNYITVTAAVTPTPTVTAPTGGVLPDYNNIFVTMANTGGIKYNAFGNNTYKIMFEGA
DRGLNALHISTDPAVNFGQVTQTAAQSGTFYATDSGGKGYEDEILLLVAVNGTVPDDFKL
HVTADGYTWTPNPISNQPPTSSTYNGTTLDETFTKADLIYGPQVWKPTGNGYSYPIYYGQ
DTADTTNTFKLMFVDLNAGVLRPNAALTNQGAVRIHYSFENLTSLAAFNVYGYCQTSNNG
SDMVAWSNSLMSDRTPSGYSVTAPLPAPVAGFSANVTNGTAPLSVQFTDLSTGTPTSWSW
DFGDGTTSTTQSPSHTYVAAGNYSVNLTATNAGGSNTTTKTNYITVTTPVTPAPVANFNA
SVTNGTAPLSVGFTDQSTGTPTSWSWNFGDGNTSTVQNPSHTYTVAGNYTVNLTATNAGG
SNTITKTNYITVTASESPSAPVANFNANITNGTVPLSVGFTDLSTGAPVTWSWNFGDGNT
STMQNPVHNYAAAGNYTVNLTATNAGGSNTTVRTNYITVHAVVPPTTEPTTAPTTTVPTT
IPTTIATTIATTLPTTIPTTIATTIATTVPTKIPTTIPTTVTPTPTMQPVTANFTANVTT
GQSPLSVQFTDLSTGTIRQYFWQFGDGGASFDKNPVHTYSAAGTYTVSLVAIGSTGAEVK
TIPQYITVTGPGTPTVSPTVTTTTTAPTTTTTVTPTVTLTTATTTVTPLPTSSGHDLPIA
NFVVTYQAGAGSMGIQVTDATTNATTVKYDLGDGTITAYKNFKYTYWQPGTYTIKLIATN
DAGSSTKTVTVTVPAGSPTTTTVTPTPTATVPVTPTVTQTPVNPNLPVANFTVTFPGGIG
SMGIQVTNTAVNATSVHYNLGDGTTTAYPNFTYTYWQPGNYTINQTATNAAGSTTRTINV
TVPAVATPTTIPTTTISPTVTGTAPVYNGTHTIPGQLQAEDYDLGGEGIAYHDTTAGNEG
GVYRHDDVDIEQIDTDRSPSVGWTRAGEWLAYTVNINTAGTYTAGFRVASAHAGSSVQMY
LDDGATPLAVVNVPNTGNDAAFQTLQVLVTLPAGQHRLVLKFPGNYANINWINFA
Download sequence
Identical sequences B8GK45
521011.Mpal_1810 gi|219852407|ref|YP_002466839.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]