SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219852409|ref|YP_002466841.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219852409|ref|YP_002466841.1|
Domain Number 1 Region: 334-448
Classification Level Classification E-value
Superfamily PKD domain 1.31e-23
Family PKD domain 0.00055
Further Details:      
 
Domain Number 2 Region: 733-787
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000706
Family Type I dockerin domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|219852409|ref|YP_002466841.1|
Sequence length 787
Comment PKD domain-containing protein [Methanosphaerula palustris E1-9c]
Sequence
MPDSKHTTLTFLILILLLAVVLLVAPAGAEPVQTNGTSSIGVDQTQELKDSAALPAPRHI
FINVANDAGVKYNLDGAALGGPDNTYYIKADNGGLNELHITSDVNAPYGQVTTSGAQSGT
FYVSNTGGRGSDDDIILLVSVKGPIPDDFSFHVKSSGYTWTPSTVMNANPTEYHYVTGVD
ETFTKSDLIYGPQTWKPGSGDLPLYYGQDINDASTAQYLMFIDLKAGNMKPATFPNDTLI
NNGALKIDYSFTNLNTFAAFNGYAWCLSTTQGQGITWTNQPFTDAASGYTVTGIPRPTTT
ATTTVPTSAQTTAITTVPTSAQTTVPTTGPTAVYTTVPTTRATTIATTVSTSVPTTPPVT
PTPTVQPLVTNFTANVTAGQSPLPVQFNDTTTGAVQSYFWQFGDGGASFDQNPVHTYTTA
GTYTVSLVASGSNGAQVKTIERYINVTVPATPTPTVTMAGQIPNHYHNYLHVANDEGPRF
DSYNNGTYYQGQDNGGLNAVWLTQNLSTVQGQKITTSNKSGTFYMMDTGGRGWEDDGLVM
LAVNGTIPDDFKVHIRTSGYTWTPISKNLRPTIDQITYVDGALDETFTKDDLIYGPQLWR
PAGAANYPIYDGQNMTDTNNTFRIMFIDLRAGVIGSNTTAGSPPLQNNGGIRVDYSFENL
TTFAAFDIYGYCKDSNAGEGISWTNAVNTFSQISHGQASIGSGLCVIGVPSSTAPITIPS
ATHPPTDPNGDGLYEDLNGDGAADFNDVVLFFNQMDWIADNEPVTTFDFNKNGSIDFDDV
VLLFNML
Download sequence
Identical sequences B8GK47
521011.Mpal_1812 gi|219852409|ref|YP_002466841.1| WP_012618437.1.75456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]