SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219852430|ref|YP_002466862.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219852430|ref|YP_002466862.1|
Domain Number 1 Region: 25-295
Classification Level Classification E-value
Superfamily Pectin lyase-like 7.92e-30
Family Galacturonase 0.022
Further Details:      
 
Domain Number 2 Region: 236-384
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000119
Family Pectate transeliminase 0.079
Further Details:      
 
Domain Number 3 Region: 541-594
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000706
Family Type I dockerin domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219852430|ref|YP_002466862.1|
Sequence length 595
Comment periplasmic copper-binding protein [Methanosphaerula palustris E1-9c]
Sequence
MKHSHFFKALLIMLVLVTLVPSALAAGSISVNGPTVISSPGTYVLTKDISGGGSPAIWIQ
SSDVIFDGNGHTIDGTGTSGSFGILVNGGSGLSRVTVKNVKLTNWHYGLYFKGVSNGQIS
GVTASNNNNAGICLAYSSNNQVTGCTSTGNEQGILISFASSYNTVSGNTASNNSDSGVYV
ASTSSTVYDTTGNQINGNTLNGNYQGVYVVFSNGNTFTDNSMSDNSDYGIFADYASGTSM
IRNSISGCGQSGVVLYDARGCIISGNTATGNTDYGIWLSCSSGNTMSGNTLVNNKGGIAL
LGDDTLTSDQNIVNGNKITDNSESGLFLCRSSGNTITNNYLSNTRDVMIGGTDLASVWSV
QTKAGSSITGGSTLGGNFWGTPSGTGFSQTHADANNDGICDQSYQFSGANVDKYPLVAST
STGSGPTPTIPLPNATTVPVTTVTPDPQVTVPVVVVTSLPVVVMPPEPTPNTSTTVQTPV
ANTTPSIPVTIPVPTGTIVTPVTNTTPIATPTVTITDKQSDPIKPIGTLTTPPRDLDGDH
RYEDVNGDGKFNFDDVVTLYNDLDSITDPAQIIAFDFNANARIDFGDVVKLNSML
Download sequence
Identical sequences B8GK68
WP_012618458.1.75456 521011.Mpal_1833 gi|219852430|ref|YP_002466862.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]