SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219852487|ref|YP_002466919.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|219852487|ref|YP_002466919.1|
Domain Number - Region: 185-241
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000745
Family Rhamnogalacturonase B, RhgB, middle domain 0.039
Further Details:      
 
Domain Number - Region: 367-406
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0011
Family Rhamnogalacturonase B, RhgB, middle domain 0.031
Further Details:      
 
Domain Number - Region: 132-170
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0129
Family Carboxypeptidase regulatory domain 0.0096
Further Details:      
 
Domain Number - Region: 275-306
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0765
Family Rhamnogalacturonase B, RhgB, middle domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|219852487|ref|YP_002466919.1|
Sequence length 460
Comment PEGA domain-containing protein [Methanosphaerula palustris E1-9c]
Sequence
MIYPRAGCWSIIFYAALLSLLFVPLASADQTGSLTITSQPPGAQVLVDGAPQGSTPVNVS
NVPSGQHLVNLTLSEYHDWSVSQYVSAGQNSVITATLVPVQKNGVLIVTSHPEPASVYVD
GTYRGITPLTLSDAGSGTHQLTVTATGYDPAIATALVPEGGSFSIDLQLNQTPTTGSLLI
GAVPPNADVVIDGVDYGGADHLIEALRPGSHQVLLKADGYQQYQTDITITAGRTLSINAT
LDPLQQRGSLNVTSVPSRASVKVDGVYLGLTPMVYPGLSAGTHQLTVSADGYSDVVVPVQ
IRAGEELPYMARLVQQMVTTGVTASTRTTGQQTASTQAATGMIRVSTTPMDANITVDGVF
RGVAPQTVRDIPVGTHQVVLSKTGYQDQSRSVTVTDGQAAVVEATLTKVGTAQPAATGTG
SASSSQIPTTTQKSGPAEVPLLVIGLLIVGLFYRRDDPGA
Download sequence
Identical sequences B8GKQ0
gi|219852487|ref|YP_002466919.1| 521011.Mpal_1891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]