SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219852488|ref|YP_002466920.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219852488|ref|YP_002466920.1|
Domain Number 1 Region: 9-237
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 3.36e-44
Family Glyoxalase II (hydroxyacylglutathione hydrolase) 0.0036
Further Details:      
 
Domain Number 2 Region: 349-452
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 3.27e-24
Family Multidomain sulfurtransferase (rhodanese) 0.087
Further Details:      
 
Domain Number 3 Region: 223-350
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.57e-18
Family Single-domain sulfurtransferase 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219852488|ref|YP_002466920.1|
Sequence length 453
Comment beta-lactamase [Methanosphaerula palustris E1-9c]
Sequence
MILKKFRAEGLSHNSYLIGSGQQAAVIDPRRDCEAYITAAEAHDLKITDIFETHRNEDYL
VGSVELANQIGATIHHGEDLDFQYGMPVKDGEVFSIGSLSLTVQKTPGHTPESISIVVTD
RAVSDQAYLVFTGDLLFAGSVGRIDLTGDPAGAAALMYQSLHERLLPLGDGLIVCPAHGA
GSVCGGHISDHPFTTIGYEKNTNPFLGLEREQFIARRVQEKTYVPPYFSMMERLNRYGPP
LLPAGQSPAPLTPAEVKTCQDLGAQILDIRSPTGFAAGHIHGSLNIWREGIAAYAGWMLN
YINPIILVDDFNLDRNSVVRTLQRLGYDRVTWYLAGGFTTWSTSGNPIAQIKTWGPEDLA
DHLDDPDLLILDVRDINNRIEVGWIEGSRHRYIGELPMHLDDLPLDRLIVIHCDVGYKGS
LGASILAAHGYPRVVNLLGGIGGWINAGYPVKR
Download sequence
Identical sequences B8GKQ1
WP_012618516.1.75456 521011.Mpal_1892 gi|219852488|ref|YP_002466920.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]