SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219852515|ref|YP_002466947.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219852515|ref|YP_002466947.1|
Domain Number 1 Region: 628-774
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.12e-29
Family Family 6 carbohydrate binding module, CBM6 0.0024
Further Details:      
 
Domain Number 2 Region: 39-332
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.86e-27
Family Galacturonase 0.066
Further Details:      
 
Domain Number 3 Region: 323-408
Classification Level Classification E-value
Superfamily PKD domain 1.83e-25
Family PKD domain 0.00042
Further Details:      
 
Domain Number 4 Region: 409-494
Classification Level Classification E-value
Superfamily PKD domain 7.59e-22
Family PKD domain 0.00042
Further Details:      
 
Domain Number 5 Region: 487-572
Classification Level Classification E-value
Superfamily PKD domain 6.41e-20
Family PKD domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219852515|ref|YP_002466947.1|
Sequence length 777
Comment carbohydrate binding family 6 [Methanosphaerula palustris E1-9c]
Sequence
MMLKVREMNRALLILLAAVCLLLLIVPTGASTPVYGPDRVFINESGTYELMNDLTYGSGE
PLIVINASDVVLDGQGHTIHAMYDQEGTGIVVNPEGESPTVQLSNVTIKNVNLDNLTYGI
VFFNSRGCTVQGVAMTGNGMDIFLSNNCTENTISGNTFSDGIGIYLLDSCRSNTISKNTF
TGCLPGIYMSGDCDQNTICENTFTGNVYGILISDSNNNIVKGNSIINSMTCGLVVGGGSG
NTIYNNYFNNLQNVFVAGHDSTNIWNIDRTAGPDIMGGPTIGGNFWGTPDGTGFSQTDPD
INNDGFCDDPYTIGTGNIDRYPLRFWPPTVTAGFYAFGHVGQAPYSVRFLDQSAGSPTAW
TWDFGDGSTSTEQNPTHIYNQTGAYNVALTASNGWGSDMAIQYRCIIVNTVPAANFTANA
TAGRTPFTVQFTDQSTGASGYQWQFGDGTTSTEQNPVHTYTTPGSYTVTLVASGVNYGSV
YSQKPGYITVTDPPTVGFSANVTAGLAPLAVQFNESVNGSVQYYYWQFGDGGTSFDKEPI
HVYNKAGLYTVSFYAIGSNGSQVKTVDQYINVTSPVMPTPTTPAPLNTTTVPTTMVPTAT
VTPVPTNTTGAPTGTTVAPTATGSAYYGPHTIPGTLQAEDYDLGGEGVAYHDTTAGNEGG
IYRHDDVDIEQLDTDHSPNVGWIRSGEWLAYTVHVSTAGTYDAGFRVASSHAGSSVLVYV
DDETTPVATVTVPNTGDWPIFRTVSVPVILPAGTHRLKLSFPTDFVNINWITFAQRG
Download sequence
Identical sequences B8GKS8
WP_012618543.1.75456 521011.Mpal_1920 gi|219852515|ref|YP_002466947.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]