SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219852517|ref|YP_002466949.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|219852517|ref|YP_002466949.1|
Domain Number - Region: 8-41
Classification Level Classification E-value
Superfamily PKD domain 0.000445
Family PKD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219852517|ref|YP_002466949.1|
Sequence length 60
Comment hypothetical protein Mpal_1922 [Methanosphaerula palustris E1-9c]
Sequence
MGRPRLNRNLVHVYDVAGRYAISLSAIGSNRARTKTIEQYLNAALVTLPATATHPVPPIG
Download sequence
Identical sequences B8GKT0
gi|219852517|ref|YP_002466949.1| 521011.Mpal_1922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]