SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219852572|ref|YP_002467004.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219852572|ref|YP_002467004.1|
Domain Number 1 Region: 674-819
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.58e-33
Family Family 6 carbohydrate binding module, CBM6 0.0013
Further Details:      
 
Domain Number 2 Region: 221-310
Classification Level Classification E-value
Superfamily PKD domain 1.44e-23
Family PKD domain 0.00049
Further Details:      
 
Domain Number 3 Region: 308-392
Classification Level Classification E-value
Superfamily PKD domain 1.03e-22
Family PKD domain 0.00039
Further Details:      
 
Domain Number 4 Region: 391-474
Classification Level Classification E-value
Superfamily PKD domain 2.49e-20
Family PKD domain 0.00093
Further Details:      
 
Domain Number 5 Region: 499-577
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000000392
Family PKD domain 0.0017
Further Details:      
 
Weak hits

Sequence:  gi|219852572|ref|YP_002467004.1|
Domain Number - Region: 125-169
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.000942
Family Cna protein B-type domain 0.028
Further Details:      
 
Domain Number - Region: 36-79
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00114
Family Carboxypeptidase regulatory domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|219852572|ref|YP_002467004.1|
Sequence length 823
Comment carbohydrate binding family 6 [Methanosphaerula palustris E1-9c]
Sequence
MMTLMKRMTWLLIVLTLISCLLLIAPVSAGPAATTNLTGTVVDQFTGLPIPGVEIDTKEG
TAYSLADGSFSLPNTIVGFDDGQYFVKLDFQDENCYDEYRTTVNVTEAEVYHSKDLGTIK
LTPGVAGYVYNSVTHQPVSDVQLTLTDPSSGDFLISSTTSKNTGYYIFPLNLNEQGLNHF
NGSTISYGYIPPNYTLTAVKNGYQSYSNSEIRITYKGSDDGVPHNIQLVPIFTAGFYAFG
HVGQAPYSVRFLDQTVGSPTAWKWDFGDGTTSTEQNPTHIYNQTGAYNVVLTASNDETSD
TCTQYRCVIVNTVPTANFTANVTSGPTPLTAQFTDESSTASGYQWQFGDGATSTDQNPVH
TYTQPGSYTVTLVISSADYGSVYTQKTGYITVSDPPMVGFTANVTAGLAPLGVQFNESIN
GSVQYYYWQFGDGGTSFDQNPVHRYDTAGRYTVSLYAIGSNGTQVKTVDDYINVTAPVTP
TPTVTVTSTVTPAPTATGYPPVANFTVTPQGGAGSMGILVTDTSVNATSVRYDLGDGTTT
AYRNFQFTYWQAGTYTIKQTATNAAGSSNKTISVTVPTVPVTTTPTSEGGDQGWYTIHCN
VDGATVLFDQTTKGTIAQGILKIQVYTTGTPYRTYTVQKDGYTTVSGTITDHPGKDQNVD
ITVNLTPTGQAYNGPHNLPGTLQAEDYDLGGEGVAYHDTTPGNEGGVYRHDDVDIEQLDT
DGSPNVGWIRAGEWLAYTVNVSTAGTYDAGFRVASSHAGSTVQVYVDGGTTPVATVTVPN
TGDWPVFQTVSAQVTLPAGQHRLRLVFPTDYVNINWITFALRG
Download sequence
Identical sequences B8GKY5
WP_012618600.1.75456 521011.Mpal_1978 gi|219852572|ref|YP_002467004.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]