SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219852656|ref|YP_002467088.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219852656|ref|YP_002467088.1|
Domain Number 1 Region: 728-870
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.41e-32
Family Family 6 carbohydrate binding module, CBM6 0.0018
Further Details:      
 
Domain Number 2 Region: 341-427
Classification Level Classification E-value
Superfamily PKD domain 3.4e-25
Family PKD domain 0.00049
Further Details:      
 
Domain Number 3 Region: 425-510
Classification Level Classification E-value
Superfamily PKD domain 1.7e-23
Family PKD domain 0.00052
Further Details:      
 
Domain Number 4 Region: 517-591
Classification Level Classification E-value
Superfamily PKD domain 1.16e-18
Family PKD domain 0.0014
Further Details:      
 
Domain Number 5 Region: 608-696
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000000706
Family PKD domain 0.0029
Further Details:      
 
Domain Number 6 Region: 68-222
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000000209
Family YWTD domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|219852656|ref|YP_002467088.1|
Sequence length 870
Comment carbohydrate binding family 6 [Methanosphaerula palustris E1-9c]
Sequence
MKVITGLMGGVLLVFALVAVCCTPVSASSLFVGAPSPTMDVPNTVNEFSVSGSTAQYQQN
LTISRSNSFFNIKGMAVDASNRTLFVTNNRYHPTGYNITVINATTMQPVTNLSLSATFRA
GKCVFDQGHDRLYVYDTNGGDLVGYTWDSDNLTLTPDGMSIPLSEGCNGLDIDPDEYLLY
VITYNGTIQKYSSASGVFLGNVSLPVDTGAYSLAVDDVTHCLYMETVSSDQCTYSLLRLD
PYGILPTRSIVYQHLDQYSYHSDLFLKLAVDPASHYLYAGTTRKVSDDDDPLMIPELRIY
DSDLNLQNTIPVGPPDITATRDDHLLVPGYLAILSDGIVPPTPTPTSAITANFYAFGHVG
QAPYSVRFLDQSTGSPTAWKWDFGDNTTSTEQNPTHVYNRTGAYNVALTASNDQASDTCT
QYRCVIVNAVPAANFTANTTAGKTPLTVQFIDQSTSGADGYQWQFGDGTTSTEQNPVHTY
TTPGSYSVMLTVSEPDYGSVFVQKPGYITVGDPSTIGFSANVTAGLSPLAVQFNESVNGS
VQYSFWHFGDGSTSMDSNPVHVYDTPGQYTVSLMTVGSNGTETKTVEDYINVTNPVTPAP
TTPAPVNTTVIPTPTEQNLPVANFTVTAGAPGSLAIQVIDTSVNATSVSYDLGDGTTTSY
PTFRYTYWQAGTYTIEQTATNAVGSSHKTLTVTVPAAAPTTTPTVTPTTTTTVSPTVTGN
PYNGPHTIPGTLQAEDYDLGGEGVAYHDTTPGNEGGVYRHDDVDIEQLDTDGSPNVGWIR
AGEWLGYTVNVSTAGTYNAGFRVASSHSGSSIQVYVDNGTTPVATVNVPNTGDWPVFRTV
SVPVTLPAGQHRLRLSFPTDYVNINWITFV
Download sequence
Identical sequences B8GDL4
521011.Mpal_2066 gi|219852656|ref|YP_002467088.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]