SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219852657|ref|YP_002467089.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219852657|ref|YP_002467089.1|
Domain Number 1 Region: 674-819
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.19e-32
Family Family 6 carbohydrate binding module, CBM6 0.0014
Further Details:      
 
Domain Number 2 Region: 367-453
Classification Level Classification E-value
Superfamily PKD domain 1.31e-23
Family PKD domain 0.0005
Further Details:      
 
Domain Number 3 Region: 454-540
Classification Level Classification E-value
Superfamily PKD domain 1.57e-22
Family PKD domain 0.00031
Further Details:      
 
Domain Number 4 Region: 533-617
Classification Level Classification E-value
Superfamily PKD domain 4.97e-22
Family PKD domain 0.00067
Further Details:      
 
Domain Number 5 Region: 96-339
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 1.9e-16
Family SGL-like 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219852657|ref|YP_002467089.1|
Sequence length 819
Comment carbohydrate binding family 6 [Methanosphaerula palustris E1-9c]
Sequence
MQYAMQIDAFIGSSPNFQYTNTTSDLVLMIVTTEKMRWVLLMSALVAVCCTPVYASSLFT
GAPSPTSSVPNTVSEFSVSYSADQYQRNLTIPRSDSFFDIAGMAVDAPNRTLFVTTGRYI
HQGYPESYNLTVIDTTTMQQVTTVPMLDVMTGVSGSAFDSGHNRLYVYSSDLGSLFRYVW
DSTTQTLTLDGDPIGLSDGCSAFAVDPVEDVLYVVTYSGTIQRYSTVSGSRLEDLTLPEP
MEVNFLTVDEVNHCLYMWAMASDSTIHLVCLNPTSNLLTQGDTITGAEVTAQVVDPASHY
LYVGTTRKVSDGDDPLMIPEIRVYDSSLRLKNTIPAGPSDLIATKSDHLLEPVYLAIISD
GIVPPTPTPTPTSAITAGFYAFGHVGQAPYPVRFLDQSTGSPTAWKWDFGDNTTSTEQSP
THIYNQTGAFNVALTASNDQASDTCTQYRCVIVNTVPAANFTANATAGRTPFTVQFTDQS
TGATGYQWQFGDGTTSTEQNPVHTYTTPGSYSVMLTVSEPNYGSVYTQKPGYITVTDPPT
VGFSANVTAGLAPLAVQFNESTNGSVQYYYWQFGDGGTSFDQNPVHIYTNAGSYTVSLYA
IGSNGTEAKTVDQYITVTSPVTPTPTTPAPVNTTTVPTTLVPTATVTLVPTNTTVVPTVT
TVAPTVTGSAYNGPHTIPGTLQAEDYDLGGEGVAYHDTTLGNEGGVYRHDDVDIEQLDTD
GSPNVGWIRAGEWLAYTVNVSTAGTYNAGFRVASSHSGSSIQVYVDNGTTPVATVSVPNT
GDWPVFRTVSVPVTLPAGQHRLRLSFPTDYVNINWISFT
Download sequence
Identical sequences B8GDL5
gi|219852657|ref|YP_002467089.1| 521011.Mpal_2067 WP_012618685.1.75456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]