SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219852660|ref|YP_002467092.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219852660|ref|YP_002467092.1|
Domain Number 1 Region: 657-802
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.53e-32
Family Family 6 carbohydrate binding module, CBM6 0.0013
Further Details:      
 
Domain Number 2 Region: 205-294
Classification Level Classification E-value
Superfamily PKD domain 2.88e-24
Family PKD domain 0.00049
Further Details:      
 
Domain Number 3 Region: 292-377
Classification Level Classification E-value
Superfamily PKD domain 4.97e-23
Family PKD domain 0.00035
Further Details:      
 
Domain Number 4 Region: 384-458
Classification Level Classification E-value
Superfamily PKD domain 1.03e-18
Family PKD domain 0.0012
Further Details:      
 
Domain Number 5 Region: 481-556
Classification Level Classification E-value
Superfamily PKD domain 0.000000000000288
Family PKD domain 0.0012
Further Details:      
 
Domain Number 6 Region: 127-218
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000209
Family Pre-dockerin domain 0.044
Further Details:      
 
Weak hits

Sequence:  gi|219852660|ref|YP_002467092.1|
Domain Number - Region: 34-78
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000157
Family Pre-dockerin domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|219852660|ref|YP_002467092.1|
Sequence length 802
Comment carbohydrate binding family 6 [Methanosphaerula palustris E1-9c]
Sequence
MTTQLQRLIRPLIVLILVSSLLLIPPVTAMHTETLTGTVVDSYTHQPINHVEITTSQVPG
PHFYTDSNGVFSIEVDNSQSGISYTLGLTPPEAADYQYRDREITYSFSAAEISARSKDLG
QIELTRKVSGYVTDSVTGQPLSGVHVSLGPSSGTSDGNGYYYIRLQDAGLNQNGLSFRGV
YYLIATKDGYLSSSIPFGIYDGDGTHLYNIQLTRAFTANFYAFGHVGQAPYSVRFMDQSV
GSPTAWKWDFGDNTTSTEQNPTHVYNRTGAYNVALTASNDQASDTCTQYRCVIVNDVPVA
NFTTNATSGQTPFSVQFTDQSTSGADGYQWQFGDGATSTEQNPVHTYTTSGSYTVMLTVS
EPNYGSVFVQKPGYITVGDPSTIGFSANVTTGLSPLPVQFNESVNGSVQYSFWHFGDGST
SMDSNPVHVYDTPGQYTVSLMTVGSNGTETKTIEDFINVTAPVTPTVTPTSTVTPTPTGA
LPVANFTVMAGAPGSLAIQVTDTSTNATSVRYDLGDGTTTAYRNFQFTYWQAGTYTIEQT
ATNAAGSSMKTVEVIVPATTPTPTITFPPIGGDQGWYTVHCNVDGATVIFDQTTMGTIAQ
GILKIPVYVTGSPYGTYTVQKDGYSTVSGVITEHPGKDQNVDITVHLTPTSTPYNGPHTI
PGTLQAEDYNLGGEGVAYHDTTAGNEGGAYRHDDVDIEQLDTDGSPNVGWIRAGEWLAYT
VNVTTAGTYNAGFRVASSHSGSTVQVYVDDGTTPVATVSVPNTGDWPAFQTVSMPVTLPA
GQHRLMLKFPTDYVNINWISFT
Download sequence
Identical sequences B8GDL8
WP_012618688.1.75456 gi|219852660|ref|YP_002467092.1| 521011.Mpal_2070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]