SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219852791|ref|YP_002467223.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219852791|ref|YP_002467223.1|
Domain Number 1 Region: 366-446
Classification Level Classification E-value
Superfamily PKD domain 8.63e-26
Family PKD domain 0.00043
Further Details:      
 
Domain Number 2 Region: 449-532
Classification Level Classification E-value
Superfamily PKD domain 1.24e-25
Family PKD domain 0.00043
Further Details:      
 
Domain Number 3 Region: 284-362
Classification Level Classification E-value
Superfamily PKD domain 3.01e-23
Family PKD domain 0.00055
Further Details:      
 
Domain Number 4 Region: 753-835
Classification Level Classification E-value
Superfamily PKD domain 7.19e-22
Family PKD domain 0.00077
Further Details:      
 
Domain Number 5 Region: 549-631
Classification Level Classification E-value
Superfamily PKD domain 1.83e-21
Family PKD domain 0.00072
Further Details:      
 
Domain Number 6 Region: 646-732
Classification Level Classification E-value
Superfamily PKD domain 1.44e-20
Family PKD domain 0.00077
Further Details:      
 
Domain Number 7 Region: 39-248
Classification Level Classification E-value
Superfamily Pectin lyase-like 6.81e-18
Family Galacturonase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|219852791|ref|YP_002467223.1|
Sequence length 838
Comment periplasmic copper-binding protein [Methanosphaerula palustris E1-9c]
Sequence
MNILLEKGSIRLVRSALLLMLVLSMLLLIFGSASAVSVTGPMVITEPGTYQLDQDISAGD
AGVCIRILCSDVTIEGNGHTLEGSGGDSSCGVLVHGSVSLSNVKVQNLHLSDWYYGVYYW
DASGTIQENTLSGNTYGVVLNPGGGSTVSGNTVTAGQYGMVFASSSAPIAVTGNTLAQNA
LVGLYLYEASHLTITNNYLDCDQNVLTGDGVSGIVWSTPREDGTTITGGNVLGGNFWAAP
NGKGFSQTMTDSDGDGICDRSYPIGGGMFDEFPLHASGGTSSTVHAGFSVSNTSGEAPFS
VSFLDTSTGLPTQWFWLFGDGESATVQNPVHLYTEPGVYTVTLRVKNSAGEDYEVMNRLI
TVSGPLEKPAADFRATPEAGKAPLTVQFVDISTGDPIGWTWDFGDGGVSSDQNPAHIYTK
AGTYPVMLTVMNNAGQSVLLKRDLISVSAAVAAPVAAFRVSADEGIDPLTVQFTDLSTGD
PTGWYWNFGDGETSQEQNPTHTYHGARSYTVSLQASNDGGSSVATREDMVTVSTAGDQPT
PTATVTASPAGPLQAQFSVDHTSGSDPLTVRFTDLSSGSPTGWYWNFGDGETSQEQNPTH
TYHGARAYTVSLQARTADDRVVITKEDVVTVTSAGSQPTVTPTATVTASPAGPLQAQFGV
DHTSGTDPLTVHFTDLSSGSPTGWYWNFGDGETSQEQNPTHTYHGARAYTVSLQARTADD
RVVITKEDVVMVTGAGSQPTVAPTATATASPAGPLQAQFGVDHTSGTDPLTVHFTDLSSG
SPTGWYWNFGDGETSQEQNPTHTYHGARAYTVSLQARTADDRAVVTKEDVVTVIPPRV
Download sequence
Identical sequences B8GDZ9
WP_012618819.1.75456 gi|219852791|ref|YP_002467223.1| 521011.Mpal_2204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]