SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219852845|ref|YP_002467277.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219852845|ref|YP_002467277.1|
Domain Number 1 Region: 12-286
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.44e-46
Family ROO N-terminal domain-like 0.00000148
Further Details:      
 
Domain Number 2 Region: 252-405
Classification Level Classification E-value
Superfamily Flavoproteins 3.19e-33
Family Flavodoxin-related 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219852845|ref|YP_002467277.1|
Sequence length 407
Comment beta-lactamase [Methanosphaerula palustris E1-9c]
Sequence
MKATATELAPGVYWVGAIDWNLREYHGYTLPGTTYNAYLVVGTEKVALIDNTYPGFEKQL
LARVSEIIDPAKIDLIVANHVEIDHSGGLPGMAKLIPGVPIYCTEAAVTGFGRHYDTTNW
NFVQTKSGDSVNLGGKTLVFLEAPMLHWPDSMFTYLAEEKILFSNDAFGQHIASAARFDD
EIGKDEALLHAKKFFANLLTPLAKKVLKKLDEVGTLGIEIKMIAPSHGVIWRSYVADLLG
AYVNWSKGVSKDKVTIVFDTMHHSTDMMAQALAEGVMAEGVDVKVCILKDGKVEGTHRSN
IASEILDSKAVLVGSPTLQDEVYPTVADFLSYLRGLRPGKLEHKKIGFAFGSHGGKGGAI
HYITDSLRTAGIEVINEGFEVHYRPDGSELDRCFEMGQDIARRVKTL
Download sequence
Identical sequences B8GE53
WP_012618873.1.75456 gi|219852845|ref|YP_002467277.1| 521011.Mpal_2265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]