SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219852881|ref|YP_002467313.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219852881|ref|YP_002467313.1|
Domain Number 1 Region: 189-435
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 2.35e-112
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.0000000213
Further Details:      
 
Domain Number 2 Region: 3-188
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 7.46e-77
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|219852881|ref|YP_002467313.1|
Sequence length 437
Comment methyl-coenzyme M reductase subunit beta [Methanosphaerula palustris E1-9c]
Sequence
MAKYQETIDLYDDEGKLLKSGVNLEKISPLVNPGIKKIIDLTKRTIAVNLNGIQEGLKSG
KLGGKANQILGRSLNYDIVKDHEAITERIKKMIEVEEGDDTTIRTIGNGKMLMIEVPSAR
LASASTYDAAITSVASATTLALLDQYNIGMFDASVVKAAVWGTYPQTMDMQGANVVSILS
IPQNNEGLGFSLRNVAANQSVMMTHRNAFQGAALASTFEQAGEFEMGMAIGPFERAQLLG
FAYQGLNANNIVYDLVKKNGATGTVGTVVQSLVERALEDKVITPGKKGKSGYIFYDTKDP
MLWNAYTAAGTLAATMVNCGAGRFAQAVSSTLLYFNDLLEHETGLPGCDYGRVMGVAVGF
SFFSHSIYGGGGPGIFNGNHVVTRHAAGFGMPCIVSACALDAGTQMFTPEGTAKIFEDTY
GQLPEFKTPMQTIAKSI
Download sequence
Identical sequences B8GE89
gi|219852881|ref|YP_002467313.1| WP_012618909.1.75456 521011.Mpal_2305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]