SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219852885|ref|YP_002467317.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219852885|ref|YP_002467317.1|
Domain Number 1 Region: 279-559
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 1.15e-142
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.00000000274
Further Details:      
 
Domain Number 2 Region: 5-278
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.06e-140
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.0000000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219852885|ref|YP_002467317.1|
Sequence length 560
Comment methyl-coenzyme M reductase subunit alpha [Methanosphaerula palustris E1-9c]
Sequence
MAKIERSQKLFLKALKEKFAGEDPAGEHTHFARAGLEQSERKREFMKEGKKVEMERGISQ
YDPKRCHLGGIPLGQRQLMTYEISGTGTFVEGDDLHFVNNAAMQQMWDDIRRTIIVGMDL
AHNTLQKRLGKEVTPETINEYLHILNHAMPGAAVVQEHMVETHPSLVSDCYVKVFTGDDE
VADQIEPQYLLNIEKLFPAKSAEKLKAAVGKSMFQAIHIPTTVSRTCDGGTTSRWSAMQI
GMSFIAAYRMCAGEAAVADLSYAAKHAGVIQMADILPARRARGPNEPGGIKFGNFCDMIQ
ADRKYPNDPAKASLEVVGAGTMLFDQIWLGSYMSGGVGFTQYATAAYTDNILDEFVYYGM
DYLKSKYGGYSQAPATQEVVNDLATEVTLNAMEQYEQFPTMMEDHFGGSQRASVIAAASG
LTTSIGTGNSNAGLNGWYLSMLMHKEGWSRLGFFGYDLQDQCGSANSMSIRPDEGLLGEL
RGPNYPNYAMNVGHQGEYAAISGGAHFGRGDPWVLNPLIKITFADPSLVFDFSEPRREFA
KGAIREFMPAGERSLIIPAR
Download sequence
Identical sequences B8GE93
WP_012618913.1.75456 gi|219852885|ref|YP_002467317.1| 521011.Mpal_2309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]