SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219852941|ref|YP_002467373.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219852941|ref|YP_002467373.1|
Domain Number 1 Region: 24-316
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 1.77e-46
Family Serum paraoxonase/arylesterase 1, PON1 0.089
Further Details:      
 
Domain Number 2 Region: 528-578
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000667
Family Type I dockerin domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219852941|ref|YP_002467373.1|
Sequence length 579
Comment NHL repeat containing protein [Methanosphaerula palustris E1-9c]
Sequence
MHNRYMLEELEVMLVLLLFGCSVQVATAADTYQFVAQWGTSGSGDGQFNSPYGVALDGVG
TVYVTDKNLDRVQQFNATGGFIRTWGTPGSGDGLLWNPKGIAINSAGNVYIVNNWNDRVQ
RFTSTGIFLARWGTGGTGDGQFKSPSGVAVDSAGNVYVADMYNYRVQKFSSAGTLLAKWG
TEGGGDGQFDYPTGIAVDSENNVYVVDSYNNRVQKFTSNGTFLAKWGARGSGDGEFADFP
EEIAVDSTGNVFVTDTGNNRIEKFTSNGTFLAKWGGRGSGDGLFESPTGIAVDSAGRIYI
ADTGNHRIQMFAYPTPTEIPTVVVPTTIPTGIPTVVEPTVTITATPSATTTVPTEIPSVI
VPTVTVTPSIEIPVFRFTPPSLAIPRGSTNTTTLFLDGLNITSGYNVTLGLTLLNPAISE
IVGVSLPGWTMAKNLTLPSDTVWLTTLNTAGLGEPTASGARIGTITIRGDQGGETALCVI
QAYVSDEKGKPVAPQLAVCPIEVTIPYRPLPGTSSNPNDLNGDGLYEDINGDGVLDFNDV
ILFFNQMDWIADNEPVIGFDFNENGQIDFNDVVLLFNQL
Download sequence
Identical sequences B8GEE9
gi|219852941|ref|YP_002467373.1| 521011.Mpal_2369 WP_012618969.1.75456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]