SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219853047|ref|YP_002467479.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|219853047|ref|YP_002467479.1|
Domain Number - Region: 179-258
Classification Level Classification E-value
Superfamily Aquaporin-like 0.0275
Family Aquaporin-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219853047|ref|YP_002467479.1|
Sequence length 274
Comment hypothetical protein Mpal_2481 [Methanosphaerula palustris E1-9c]
Sequence
MKSITAERLRPDFEPVALLWSDTKPDGALQIKPHAQTCIMPFFAQVVTKGKTAVFDRDTC
GCPGARAGLGFGNGYYDAFSGAGTAFMAAFFVKGAESSRDPDAYCAIVQHVPKKEQAKFI
RGERLHSSTEKAERFMTRDLPITDIAERYVIVTPLSQVKPGERPVVVIFVANPLQIAGLV
TLVGAIREGTDPVRVPPMAACQQIGAFVYDEAKMEHPRAVLGYTDLAARANVGAALPEHM
FTFAVPFSLFMEMEEEAEDGVFDGPIWRGLVGEV
Download sequence
Identical sequences B8GEQ5
WP_012619075.1.75456 gi|219853047|ref|YP_002467479.1| 521011.Mpal_2481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]