SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219853178|ref|YP_002467610.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219853178|ref|YP_002467610.1|
Domain Number 1 Region: 16-235
Classification Level Classification E-value
Superfamily SGNH hydrolase 1.32e-32
Family Acetylhydrolase 0.078
Further Details:      
 
Domain Number 2 Region: 263-398
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.14e-25
Family Family 6 carbohydrate binding module, CBM6 0.0023
Further Details:      
 
Domain Number 3 Region: 471-520
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000192
Family Type I dockerin domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219853178|ref|YP_002467610.1|
Sequence length 522
Comment carbohydrate binding family 6 [Methanosphaerula palustris E1-9c]
Sequence
MLWCSIVLAMLLGGSLLVIPAEATVKILPLGDSITRGGATADSPYPSYRYLLWNYLKTGG
YDVDFVGSTTEPTFSSFSFDQDHDGHGGYTTGMELNGDPSDDPQGKLSKWLNQYTPDIVL
LHIGTNDVIHQVDLSERLSNVGQIIDTLRAANPNVEILMAQIIPTSDAFRNSNSQLIAFN
DALPALAADKNTAQSPVIVVDMYSNYDGFKDNQYDGIHPQTSGEKKLADRWYAALVPLLN
NSTVTPEPTTAPWNTSQQIPGSIQACDYAPGGEGVAYYDTTPGNSGGAYRSDDVDIEYSS
AEQQFVVRDIRSGEWLTYNVKIASAGLYTVNFRVASPNTGATIDMEVDGSEVTTIQVPDT
GSSALYTTVQRPVYLPGGNHTVKLDFSGSFNLNYLKFTTGLPDPIGTSTPETTATPVTTS
TTVTNNTTVSPTDSQTVPATTAPTTAPTPPLPLPSSVDAPHDLNNDGLYEDVNGDGALDF
NDVVLFFNQMDWIADNEPISAFDFNHNGTIDFNDIVILFNEM
Download sequence
Identical sequences B8GF81
521011.Mpal_2618 WP_012619206.1.75456 gi|219853178|ref|YP_002467610.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]