SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219853189|ref|YP_002467621.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219853189|ref|YP_002467621.1|
Domain Number 1 Region: 231-497
Classification Level Classification E-value
Superfamily NHL repeat 4.97e-49
Family NHL repeat 0.000035
Further Details:      
 
Domain Number 2 Region: 43-307
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 9.48e-46
Family SGL-like 0.038
Further Details:      
 
Domain Number 3 Region: 764-854
Classification Level Classification E-value
Superfamily PKD domain 1.44e-23
Family PKD domain 0.001
Further Details:      
 
Domain Number 4 Region: 678-770
Classification Level Classification E-value
Superfamily PKD domain 7.59e-22
Family PKD domain 0.0013
Further Details:      
 
Domain Number 5 Region: 590-683
Classification Level Classification E-value
Superfamily PKD domain 1.18e-21
Family PKD domain 0.0011
Further Details:      
 
Domain Number 6 Region: 468-602
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 3.6e-19
Family SGL-like 0.051
Further Details:      
 
Domain Number 7 Region: 876-930
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000118
Family Type I dockerin domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219853189|ref|YP_002467621.1|
Sequence length 930
Comment PKD domain-containing protein [Methanosphaerula palustris E1-9c]
Sequence
MRSAFFLFLFCVVLLLCSIVQVVSAEGGYTYTAQWGNGGLGYGRFSDPEGVAVDGTGAVF
VADRLSNRILKFTSTGEFITQWGSEGSGNGQFENPGGIAVDSAGNIYVTDTWNHRVQKFT
STGEFITKWGGEGSGDGQFSYPYGIAADRAGNVYVTDTWNHRIQKFDATGAFITKWGSDG
SGDGLFENPGGIAVDSAGDVYVTDSWNPRVQKFNSTGTFITRWGSEGSGDGQFGTSYGIA
VDSAGNVYVVDIGTHRVQEFTSTGEFITKWGGYGSGDGQLSYPRGIALDSAGNVYVVDTG
NNRVQKFTSTGTFITKWGGEGSGAGELNHPHGVALDDAGNVYIIDTWNNRVQIFTSTGEF
IAKWGSKGSEDGQFIYPYSIAVDSAGNVYVVDTGNNRVQKFTSTGTFITQWGGEGFGDGQ
FNFPGGITADSAGNVYVVDTENDRVQKFTSTGEFITKWGGDGSGVGEFNYPYGIAVDRAG
NVYVVDTGNNRVQIFTSTGTFIAQWGGSGSRDGQFNYPGGIAVDSAGNVYVVDESNNRFQ
KFTSTGEFITKWGSEGLGDGEFTYPRDVAVDSGGNVYIVDESNSRIQKFSWVAQIMPLIP
SFTAVPTAGSAPLTVQFIDTTTGGATAWYWDYGDGTTSTDGTVQNPCHQYSAPGTYSVIL
TADRTTSGSRSITKKGYITVTVPPLVPNFTAVPTAGSAPLTVQFIDTTTGSPVHWYWDYG
DGTTSTDGTVQNPRHQYSAPGTYSVTLTADRVPTGNRSITKKEYITVSVPPLVPNFTATP
TSGSAPLTVQFNDTTTGGAIHWFWDFGDGTTSTDITVRNPSHLYSAPGTYSVTLYVFNDT
AGSQRIIRTGYLTVTSPMKQVPGGSAMPHDLNNDGLYEDVNGDGAVDFSDVVLFFNQMDW
IAENEPVSAFDFNRNGTIDFNDVVMLFNTL
Download sequence
Identical sequences B8GF92
521011.Mpal_2630 WP_012619217.1.75456 gi|219853189|ref|YP_002467621.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]