SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219853225|ref|YP_002467657.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219853225|ref|YP_002467657.1|
Domain Number 1 Region: 782-865
Classification Level Classification E-value
Superfamily PKD domain 2.49e-26
Family PKD domain 0.00029
Further Details:      
 
Domain Number 2 Region: 314-428
Classification Level Classification E-value
Superfamily PKD domain 1.19e-23
Family PKD domain 0.00081
Further Details:      
 
Domain Number 3 Region: 953-1038
Classification Level Classification E-value
Superfamily PKD domain 1.83e-22
Family PKD domain 0.00042
Further Details:      
 
Domain Number 4 Region: 47-126
Classification Level Classification E-value
Superfamily PKD domain 4.84e-21
Family PKD domain 0.00063
Further Details:      
 
Domain Number 5 Region: 866-952
Classification Level Classification E-value
Superfamily PKD domain 1.31e-20
Family PKD domain 0.00078
Further Details:      
 
Domain Number 6 Region: 1038-1121
Classification Level Classification E-value
Superfamily PKD domain 2.35e-20
Family PKD domain 0.00075
Further Details:      
 
Domain Number 7 Region: 608-688
Classification Level Classification E-value
Superfamily PKD domain 4.19e-19
Family PKD domain 0.00051
Further Details:      
 
Domain Number 8 Region: 706-783
Classification Level Classification E-value
Superfamily PKD domain 6.54e-19
Family PKD domain 0.00095
Further Details:      
 
Domain Number 9 Region: 1307-1386
Classification Level Classification E-value
Superfamily PKD domain 4.05e-17
Family PKD domain 0.0015
Further Details:      
 
Domain Number 10 Region: 166-239
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000000144
Family PKD domain 0.00093
Further Details:      
 
Domain Number 11 Region: 519-605
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000000405
Family PKD domain 0.0024
Further Details:      
 
Domain Number 12 Region: 1138-1280
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000000221
Family Family 6 carbohydrate binding module, CBM6 0.0041
Further Details:      
 
Domain Number 13 Region: 446-519
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000000222
Family PKD domain 0.0017
Further Details:      
 
Domain Number 14 Region: 269-338
Classification Level Classification E-value
Superfamily PKD domain 0.0000000196
Family PKD domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|219853225|ref|YP_002467657.1|
Sequence length 1387
Comment PKD domain-containing protein [Methanosphaerula palustris E1-9c]
Sequence
MRLPKSNPSGRLFLVSLMVIMACLLIPGAFAASATADHTNDKGYGGIGPIVNFTVDHSSI
TAGDSVKFTDTSYDNITSQAWDFGDGSISLDANPTHTYTAAGTYVVALNVQNATGYASNT
SGMTVNGYTLPSITVASVQDVAPQFNIGLNGNTYGVFGATGSASTFSNATVNVGDALTFT
DASTGVPTTWSWNFGDASDLITTQNATHTFTQAGTYVVYLTAGNVNGQKTSNSLTIVVNG
GIAPVSAFTASNNGVENSSVAGTPDYANAAYLNGTAPMTVSFTDKSTKVPSSWSWTKNGT
VFSTEQNPSLTLNQGQYQIILNATNAQGSNLSSIWINVAGPSTPIAHFVATPSTGTAPLS
VQFNDTSDGGLAAPTSWLWNFGDGTQGSTVQNATHTFTAAGTYTVTLQTRNGAGVSTPFT
GTITVNSPTTPSANFKINGSTADNYAQNPVTILVGQPVYFNDTSSGSPSSYNWIFSDGQP
VPTQANVSRSFSVPGTFWVYHTVTNAAGSDSKLNLFTVTVAPVTAAPVASFTKNATDGEA
PLTVLFTNTSTGAPTTFQWLINGVQQGTDANLTYTFATPGTYSVVLIASNAGGSSAAAAQ
TVTVSGVSGIPNANFTFTSPSFAAPSQVQFTYAGGNATQFLWTFDDGTTSTEMNPVHTYQ
NAGTYSVRLTTTNAKGTNYKINDVTITPLGNPVASFNANTTAVTKASAASAQVSGQSPFT
VVFNDTSSERPTAWYWNLGDGTTSTSQNITHTYTTPGKYAVYLVVANSLGASDYVYAPTL
INVSAPSPVTDFSATPSTGAAPLNVQFTDLSGNNPFAWAWNFGDGSISGAQNPSHTYTTA
GNYTVTLTTQNSVGTSTKSKVVSVISLSKPVSNFTFAPAAGQAPLTVQFADTSSNSPSSW
SWTFTDDFSTSNVQNPSHTFATAGTYGVLLTASNAAGAGDMKLQTITVSAAPVITPVADF
TATPTTGVAPLSVQFADKSTNADVWVWTFGDGATSTLQNPPAHTYTTAGTYTVQLQAVNS
TSSRSNTASKTITVTAAPQTLQAAFNVNAQTVQLGTAVTGTDASTGYPAAWSWDFGDGFT
ASSQNINHIYSAVGTYTLSLTVTNGTQTSTASKTINVSAAPTTTVTTTATQGQPYNGPHN
VPGTVQAEDYDLGGQNVAYYDTTSGNAGGAYRTDDVDIEAGASGYAVAYVIGGEYLTYSV
EAAADGDYPVTLRAANPDGTTKTVTVSAGSSSTPVSVASTGSFDTYNSFTSAGTLHLEQG
RNVVKVAFSASRMNLDYITIGSGVTPTTTVTTQPTTTVTTQPTTGAASFTVSPTSGKHSL
SVALTDTTTGGNPVSWKWNCGNGQTFSGQNIGLNRIWYNNAGTYTITLTVTDANGSTRTA
THTVTVS
Download sequence
Identical sequences B8GFQ1
WP_012619253.1.75456 521011.Mpal_2670 gi|219853225|ref|YP_002467657.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]