SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219853226|ref|YP_002467658.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219853226|ref|YP_002467658.1|
Domain Number 1 Region: 364-504
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.01e-26
Family Family 6 carbohydrate binding module, CBM6 0.0015
Further Details:      
 
Domain Number 2 Region: 95-332
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.61e-20
Family Papain-like 0.0078
Further Details:      
 
Domain Number 3 Region: 527-581
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000549
Family Type I dockerin domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|219853226|ref|YP_002467658.1|
Sequence length 581
Comment carbohydrate binding family 6 [Methanosphaerula palustris E1-9c]
Sequence
MQRHTLYNILVIGLILAAVGVVSAADPVTLSATNVSGDQVQSADPFMHPSPEVLKRWIDE
YNMAPEAPQPSFLRRMMASFQTEQNLLSVISYNVTERNQNPIGNCWVWASTGVLEVALSE
QQSIKDRLSIQYLDSNYNGGSGPNWAGEGGTLGDFVGFYSEKKIAVPWSNTNASFQDGTA
YSEARMKAAVAAADIQTVPNYPITSITEQRIPTAGVGDSAAIANIKGTLDSGKALYLGFV
MPNADAVVSFSNFWYYQGEDAVWNPSPFAGKPYDPSHGASHAVTIVGYNMTDPNNRYWIA
LNSMGAGASGNRPDGTFRIKMDIDYNAICPYVFTVPMTTWETEGVTFGEIPTPIPTLAPY
NGSHQVPGVLQAEDYDLGGEGIAYHDTTTGNAGGAYRSDDVDIETAGGITDIGWIRDGEW
LEYTLNVASSGSYTATFRTATWSNGKAITIQVDGQEVGTVQVPNTGGSEQYTSVSTTLPL
TAGLRHLNLSFVGDGLNLDQVSFTTGQAVQVVPGATELPRDLNSDGLYEDLNGDGSLNFN
DVVLFFNQMDWITENEPINTFDFNRDGQIDFNDIVLLFNQL
Download sequence
Identical sequences B8GFQ2
521011.Mpal_2671 WP_012619254.1.75456 gi|219853226|ref|YP_002467658.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]