SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219853304|ref|YP_002467736.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219853304|ref|YP_002467736.1|
Domain Number 1 Region: 70-303
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.54e-27
Family Papain-like 0.0042
Further Details:      
 
Domain Number 2 Region: 507-560
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000216
Family Type I dockerin domain 0.0069
Further Details:      
 
Weak hits

Sequence:  gi|219853304|ref|YP_002467736.1|
Domain Number - Region: 349-475
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.0942
Family Cellulose-binding domain family III 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|219853304|ref|YP_002467736.1|
Sequence length 561
Comment peptidase C1A papain [Methanosphaerula palustris E1-9c]
Sequence
MILFSEGAVSAAETLASNESVTTLNPIMHPNQTTLQRWIEQYEAAETVPIDQTIKDRAIQ
STGARSLLSDLPYIASERNQNPIGNCWVWAGTGVLEVAHAEQTGIKDRLSIQYLDSNYND
GSGPDWAGEGGSLTDFVQFYNQQHIAVPWSNYNANFQDGQLWSLKNMQTWIPAASIQTTP
HYDISSITGQKVQTRGVSQVTAITNIKAVLDQNRGIYLGFKLPDEAAWDDFETFWNDQGE
DAVWDPSPYVSRTWDSNTGGGHAVLCIGYDDTDPNNRYWILVNSWGTAGGKRPNGIFRMK
MDVDYSATYYGLYNLPAMQWETESVTFSATPQPVFTITTVAPIPASLGLSPKNNTMKSGG
NLSLDLNLTPSVNGLSGYIITITSDNPQVASITSATLPAWAGMTSISTLPSSTVTVMGSD
LSDQVHGAAQTIPLANLGITTGKAGTATLTVKVTGLSDDSGHPILTTSVPAVITVQAPNI
SSGVIPIQSNGDLLIGNQPTDPDHDGLYEDLNGNGVLDFNDITLFFNQMDWISGHEPLGA
FDFNGNGQIDFNDIVILFNSL
Download sequence
Identical sequences B8GFY0
521011.Mpal_2753 gi|219853304|ref|YP_002467736.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]