SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219851497|ref|YP_002465929.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219851497|ref|YP_002465929.1|
Domain Number 1 Region: 143-385
Classification Level Classification E-value
Superfamily Nqo1 FMN-binding domain-like 1.11e-82
Family Nqo1 FMN-binding domain-like 0.000000532
Further Details:      
 
Domain Number 2 Region: 470-561
Classification Level Classification E-value
Superfamily Nqo1C-terminal domain-like 5.75e-31
Family Nqo1C-terminal domain-like 0.00063
Further Details:      
 
Domain Number 3 Region: 386-469
Classification Level Classification E-value
Superfamily Nqo1 middle domain-like 2.22e-22
Family Nqo1 middle domain-like 0.00064
Further Details:      
 
Domain Number 4 Region: 24-111
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000246
Family Thioredoxin-like 2Fe-2S ferredoxin 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|219851497|ref|YP_002465929.1|
Sequence length 562
Comment NADH dehydrogenase (quinone) [Methanosphaerula palustris E1-9c]
Sequence
MKIKTADDLENVRQAGLRRLIPDRPRIAVGLATCGKAVGGDQVYDRLRQTIESEGLDIAL
TRVGCFGYCREEPLVNVAIPGKPLVILHRVTVDDVEAIIRAVLNGEVPVELALCRIPTWD
PIIGPPLVFGDGFPDIPLYADVPFFRYQQKVILRAAGLIDPGDIEEYIAVGGYSAALSAL
TTMEPEAVIDVVEKSGLRGRGGAGFPAGLKWRITRKETATEKYIICNADEGDPGAYMNRN
EMESDPHMLIEGMILGAYAIGGVKTGVIYIRAEYPLAIERLTKAIEQAREYGLLGDDILG
TGFSFDLHLAIGAGAFVCGESTALVASIEGRTGRPHPRPPRLTDKGLWGKPTDLNNVETW
CNVPVIVSRGAGWYAAIGAPGNTGTKVFSLVGKVDRVGLVEVPLGTTLERIVIDIGNGGA
GGKAVKAVQTGGPSGGCIPVRLFDTPMDYESLNRVGSIMGSGGIVVMDEDTGMVDIARYF
INFAIGESCGKCVPCREGLKHTLLLLNRLLAGKGTGQDLETLALLADTVAKTSLCGLGQS
APNPVLTTLEYFRDEYEGLIER
Download sequence
Identical sequences B8GGF1
WP_012617525.1.75456 gi|219851497|ref|YP_002465929.1| 521011.Mpal_0844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]