SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219853190|ref|YP_002467622.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219853190|ref|YP_002467622.1|
Domain Number 1 Region: 11-262
Classification Level Classification E-value
Superfamily NHL repeat 7.85e-49
Family NHL repeat 0.0000239
Further Details:      
 
Domain Number 2 Region: 292-342
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000145
Family Type I dockerin domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|219853190|ref|YP_002467622.1|
Sequence length 343
Comment SMP-30/Gluconolaconase/LRE domain-containing protein [Methanosphaerula palustris E1-9c]
Sequence
MYSTQWGSIGWGYGQFGDPCGVAVDSAGNVYVVDTGTNRVQKFTSTGTFITQWGSAGTRN
RQFFGIGGIAVDSAGNVYVTDEHNSRVQKFDSTGIFITKWGSYGPGDGQFKSPEGIAVDN
AGNVYVVDTVNNQIQKFTSDGTFITKWGTRASGIAVDSDGNVYVTDATSNQVQKFTSDGT
HLLNWGTSGSENGQFSSPEGIAVDNAGNVYVNDVGNQRVQKFTPDSTFVTSWETGASGIT
VDSDSYVYVVDRGNCRIQKFVPAGSTPTISQKKEVPGGDDTPNSTSNSTCDDVNGDGVLD
FNDVVLFFNQMDWIAENEPVSAFDFNKNNQIDFNDVVVLFNTL
Download sequence
Identical sequences B8GF93
521011.Mpal_2631 gi|219853190|ref|YP_002467622.1| WP_012619218.1.75456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]