SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|311108714|ref|YP_003981567.1| from Achromobacter xylosoxidans A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|311108714|ref|YP_003981567.1|
Domain Number 1 Region: 239-277
Classification Level Classification E-value
Superfamily HMG-box 0.000072
Family HMG-box 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|311108714|ref|YP_003981567.1|
Sequence length 324
Comment TRAP transporter solute receptor subunit DctP family protein 8 [Achromobacter xylosoxidans A8]
Sequence
MNLGNAVKALVAALALAASGSVLAQTKLKWAHVYETSEPFHTASVWAAQEIGKRTNGRYQ
IDVYPASQLGKENDINQGLTLGTVDIIISGSSFAAKSFPRIGVTYYPYIFRNPEHLIAYT
KSDIYKELTRGYDEKSGNHIVATTYYGTRQTTSNRAFTKCSEMKGLKIRVPDVAAYLAMP
RACGANTAPIAFAEVYLALQNGTVEAQENPLTTIEAKKFYEVQKNIILTGHIVDHLNTVI
SGKLWKSLSDEDKKIFSEVAQQAAEKASAEVAESEKKMVEVFRKRGLNVAEVNVADFRDT
VLEKVPFKQYGYEKSDWERIQAVK
Download sequence
Identical sequences E3HXJ9
gi|311108714|ref|YP_003981567.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]