SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000004695 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000004695
Domain Number 1 Region: 502-661
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.45e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0092
Further Details:      
 
Domain Number 2 Region: 636-759
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 8.37e-31
Family Ypt/Rab-GAP domain of gyp1p 0.0054
Further Details:      
 
Domain Number 3 Region: 86-221
Classification Level Classification E-value
Superfamily PH domain-like 9.47e-25
Family Phosphotyrosine-binding domain (PTB) 0.012
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000004695
Domain Number - Region: 947-981
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.0654
Family Trimerization domain of TRAF 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000004695   Gene: ENSDARG00000010297   Transcript: ENSDART00000021208
Sequence length 1018
Comment pep:known_by_projection scaffold:Zv9:Zv9_NA654:4983:114445:-1 gene:ENSDARG00000010297 transcript:ENSDART00000021208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVGNGSEQQLQQELEDVLMDPSVTELVVGPDHLGQGDHGYPTTAVPSRSGSVPPKLEIVL
PIQGAQESELNLPLLFKQYEPSDLSPGTPVPDEDSVVFSKLTYLGCASVNAPRSEVEALR
MVSILRSQCQMPLDVTLSVPGVSEGTVRLLDPQSSTEIANYPIYKILFCVRGHDGTPESD
CFAFTESHYNTEIFRIHVFRCEIQEAVSRILYSFATAFRRSANKAPLATKAPPLTPDSDV
FTFTVSLEIKEDDGKGTFSAVSKDKDRQSFKLRAGMDKKIVIYVQQTSNKELAIERCFGL
LLSPGKNVKNSDMHLLDLESMGKSSDGKSYIITGSWNPNTPQFQAVNEETPKDKFMYMTT
AVDLVITEVEEPVRFLLETRVRVCSPNERLFWPFSKRSYTETFYLKLRQMENKERKSNSD
TLYEVMSLESETERERRKTTASPGVLSSGSHGSTVPSPPEDDEEEDNDEPLLSGSGDVSK
ECAEKILETWGELLSRWHLNLAVRPKQLPALVRSGVPEALRGEVWQLLAGCHNNDHLVEE
YRTLITKESPQDSAITRDINRTFPAHDYFKDTGGDGQDSLYKICKAYSVYDEEIGYCQGQ
SFLAAVLLLHMPEEQAFSVLVKIMFEYGLRELFKQNFEDLHCKFFQLERLMQECIPDLYT
HFLNLGLEAHMYASQWFLTLFTAKFPLYMVFHIIDLLLCEGISVIFNVALSLLKTSKDDL
LQTDFEGALKFFRVPVPKRYRSEENAKKLMELACSMKISQKKLKKYEKEYHTIREQQEQQ
EAPIERYERENRRLQEANMRLEQENDDLAHELVSSKIALRKDLDNAEEKADALNKELLIT
KQKLVESEDEKRRLEEESAQLKEMCRRELDKSESEIKKNGSIIGEYKQICSQLSERLEKQ
QTANRGELEKIRMKVEGCEKCSNLFSKEGRLKVLSAPKEGSEEDTDEEKEALKNQLREME
LELAQTKLQLVEAECKIQDLEHHLGLALNEVQAAKKTWFNRTLSSIKTVTGAQGKESV
Download sequence
Identical sequences ENSDARP00000004695 ENSDARP00000004695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]