SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000006223 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000006223
Domain Number 1 Region: 409-510
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.26e-16
Family Ypt/Rab-GAP domain of gyp1p 0.011
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000006223
Domain Number - Region: 245-324
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000157
Family Ypt/Rab-GAP domain of gyp1p 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000006223   Gene: ENSDARG00000013842   Transcript: ENSDART00000025308
Sequence length 526
Comment pep:known chromosome:Zv9:7:62891154:62955428:1 gene:ENSDARG00000013842 transcript:ENSDART00000025308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDDSTELSVSITQIVQRLKGTHLHSQLEKQAKECLHKPEIKLETLKDDVRRVLKASGWE
RKLQNAVYRELHVLPPPGHPRAPPEHTKEPLAYMLKAQASWEKRILKSLNSMCTELGIPL
ARKRPVMEQKELTNKWNEMGTDEPDLSNFRPVYAPKDFLEVLIGLRNPNTERSDDLTVKS
HWGLIQVSLNVHDIPQMRETYAELGLSYGQLGIDDHTHVPPDLFESEHIHIGKKVVSEQD
SAAAQQYSRQGCPTGLRAQLWSLILNTTNDPEDITHYEQLKARVIHHNLLVDNLIYKDVK
LTASNDDYYFVFEDYLYQVLLCFSRDTAVLEHFNYNSASPPKSCIQSKSGSEQCAVVYPP
NGVIPFHGFSMYVAPLCFLYNEPSKLYSVFREMYIRYFFRLHSISSHPSGIVSLCLQFER
LLQAHLPQLFYHLREIGAQPLRIAFKWIVRAFSGYLSTDQLLLLWDRILGYNSLEIVAVL
ATAVFAFRAENLMEVTSLASAEAVLADLSTLKVMPLLQIFLFATSI
Download sequence
Identical sequences F1QYM1
ENSDARP00000006223 7955.ENSDARP00000006223 ENSDARP00000006223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]