SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000009713 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000009713
Domain Number 1 Region: 84-145
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 6.02e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0000728
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000009713   Gene: ENSDARG00000030110   Transcript: ENSDART00000027661
Sequence length 275
Comment pep:known chromosome:Zv9:25:32264524:32266764:-1 gene:ENSDARG00000030110 transcript:ENSDART00000027661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSDIPFPIPSADDFYDDPCFNTNDMHFFEDLDPRLVHVSLLKPDEHHHIEDEHVRAPS
GHHQAGRCLLWACKACKRKTTNADRRKAATMRERRRLSKVNDAFETLKRCTSTNPNQRLP
KVEILRNAISYIESLQALLRSQEDNYYPVLEHYSGDSDASSPRSNCSDGMMDFMGPTCQT
RRRNSYDSSYFNDTPNADARNNKNSVVSSLDCLSSIVERISTETPACPVLSVPEGHEESP
CSPHEGSVLSDTGTTAPSPTSCPQQQAQETIYQVL
Download sequence
Identical sequences Q90477
ENSDARP00000009713 NP_571337.2.45394 ENSDARP00000009713 7955.ENSDARP00000009713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]