SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000009789 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000009789
Domain Number 1 Region: 103-168
Classification Level Classification E-value
Superfamily Chromo domain-like 2.23e-26
Family Chromo domain 0.0000248
Further Details:      
 
Domain Number 2 Region: 9-68
Classification Level Classification E-value
Superfamily Chromo domain-like 3.97e-22
Family Chromo domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000009789   Gene: ENSDARG00000003860   Transcript: ENSDART00000012352
Sequence length 174
Comment pep:known chromosome:Zv9:19:20267294:20270413:-1 gene:ENSDARG00000003860 transcript:ENSDART00000012352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKKQAGKSKKEVQEIEEFVVEKVMDQRVVNGKVEFFLKWKGFTDADNTWEPEENLDCPE
LIAAFLESQKGVVEKPEAVKRKSSTDEPETEESKAKRKKEMSDKPRGFARNLEPERIIGA
TDSSGELMFLMKWKDSDEADLVPAREANTRCPQIVIAFYEERLTWHSCPEDEQQ
Download sequence
Identical sequences ENSDARP00000009789 7955.ENSDARP00000009789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]