SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000010206 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000010206
Domain Number 1 Region: 10-75
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000327
Family HLH, helix-loop-helix DNA-binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 89-133
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000379
Family Hairy Orange domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000010206   Gene: ENSDARG00000016363   Transcript: ENSDART00000019035
Sequence length 221
Comment pep:known chromosome:Zv9:7:27555810:27562304:-1 gene:ENSDARG00000016363 transcript:ENSDART00000019035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTASNMGNGPEKNFNAKEERKLRKPLIEKKRRERINSSLEQLKGIMVDAYNLDQSKLEKA
DVLEITVQHMENLQRGHGQGGSNSPGTGFESRQRYSSGYIQCMHEVHNLLLSCPGMDKTL
GARLLNHLLKSLPHISTEPSGTSSAGTSSPLPLSPTQSPINLPSSLQPHALLLSPSPPSS
PTHSLVRPREQSSPPSSPSPQSPASLPPFFPGVDPSMWRPW
Download sequence
Identical sequences F1QI81
ENSDARP00000010206 7955.ENSDARP00000010206 NP_955918.3.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]