SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000010424 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000010424
Domain Number 1 Region: 105-179
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.32e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000010424   Gene: ENSDARG00000019646   Transcript: ENSDART00000011146
Sequence length 199
Comment pep:known chromosome:Zv9:23:103338:110023:-1 gene:ENSDARG00000019646 transcript:ENSDART00000011146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MREEQTCGDFPESGILPIEEEQERRPNKCAVVVSPPAGARKRLTGPKKEPVSQDDKPSLD
NPSNLAPKRPKRSSPSSSSSSSSSLVPVVSSVSPVPGQPFEDLHTQRVIANVRERQRTQS
LNDAFASLRKIIPTLPSDKLSKIQILKLASRYIDFLYQVLQSDEMDAKLASCNYLAHERL
SYAFSVWRMEGAWSMSATH
Download sequence
Identical sequences Q6DBZ9
ENSDARP00000010424 ENSDARP00000010424 NP_571060.2.45394 7955.ENSDARP00000010424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]