SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000011265 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000011265
Domain Number 1 Region: 115-175
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.09e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000011265   Gene: ENSDARG00000014479   Transcript: ENSDART00000021987
Sequence length 265
Comment pep:novel chromosome:Zv9:2:29425689:29426593:1 gene:ENSDARG00000014479 transcript:ENSDART00000021987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTVLDPFTGLDSFSSSYFDDDDFFTDHSSRDHLDTDDFLDEDVDFLTNQIQEYYKDSRI
SQDGDYCDVGNFSFSSSSSTFSYGCADSTSELSPHRDGGLLKRRRRMRSEVEMQQLRQAA
NVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLAELVQSDMPIRNP
HSDALNQPKKVIICHRGTRSPSPNDPDYGLPPLAGHSLSWTDEKQLKDQNIIRTAKVWTP
EDPRKLHLKSSINNIENEPPFNFIS
Download sequence
Identical sequences Q7ZSX3
ENSDARP00000011265 NP_997524.1.45394 ENSDARP00000011265 7955.ENSDARP00000011265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]