SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000011455 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000011455
Domain Number 1 Region: 1026-1325
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.32e-66
Family Tandem AAA-ATPase domain 0.0000423
Further Details:      
 
Domain Number 2 Region: 752-1024
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.87e-58
Family Tandem AAA-ATPase domain 0.0000325
Further Details:      
 
Domain Number 3 Region: 630-695
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000000000000636
Family Chromo domain 0.026
Further Details:      
 
Domain Number 4 Region: 701-769
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000000216
Family Chromo domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000011455   Gene: ENSDARG00000075543   Transcript: ENSDART00000013676
Sequence length 2160
Comment pep:known chromosome:Zv9:2:37794895:37818491:-1 gene:ENSDARG00000075543 transcript:ENSDART00000013676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPIMDLFDDTPLFNLDSLPEDAFSQGSSDPVEEALKLALGQVDPPTDPIPDPGVPILS
DVVTDPALIPTPVSVPLQNLQTQQLSQIPHEVSVASAPISIQPSLSVASNSSGAATVLLS
SSLGVPVSGAQVTPQQQTQQITAVTQQAAGQHAPKIVILKGPQGQTQVLQGVTGATGSPG
KVTLARVLTGTPLRPGMAVVSGGTVLNATSPAQGQVKVGTGVQRLVQTANGPMKQVALQT
QAQTQTPTSPAAAGIRPQSVTLSAVPQQGEAKRITLVLQQPSQGGAQGQQPRLVLGSLPG
KLVLQGDQLAALAQAKAGQTGAQAKVLTIQLQVQQQPNQQGAKQFQLVSGAANAGGSPQV
VQISQGQGGQRLAVPLKLLLQPQSNTVSSAGGAVSVVKVINTSAAGSTSGTTTTAASSGV
RLAKIQEPVRRVETLCKQEKANRIVAEAIARAKARGERNIPRVLNQDELPAGQTSAGGSK
KKSPSAGGAKMVVGGDKKSKAKTPVIPGGGSKSKSKTKLNTITLVGKKRKRNPSSDHSDV
DLSPPVSPRTLEEEMSQKRRSNRQVKRKKYTEDLDIKITDDEDELDADVDVTTTPMPAVG
HVQPLGAELPPELDGDGLPSMQFFVENPSEEDAAIVDKILSMRVTKKEVCPGQYTNVEEF
FVKYKNYSYMHCEWASLEQLERDKRIHQKLKRFKTKQAQMRNLFQEDEEPFNPDYVEVDR
ILDESHSVDKDNGEPVVYYLVKWCSLPYEDATWELKEDVDEGKVEEFRKIESRQPRLKRT
PRPAASAWKKLDESTEYKNGNQLREYQLEGVNWLLFNWYNRQNCILADEMGLGKTIQSIA
LLSEMFSAGVQSPFMIIAPLSTITNWEREFSNWTDMNAIVYHGSLASRQMIQQYEMYCKD
DKGHLIPGAYKFDALITTFEMILSDCPELREISWRCVVIDEAHRLKNRNCKLLDSLKMLE
IEHKVLLTGTPLQNTVEELFSLLHFLEPAQFPSEIEFLREFGDLKTEEQVQKLQSILKPM
MLRRLKEDVEKNLAPKQETIIEVELTDVQKKYYRAILERNFSFLSMGATQNSNVPNLLNT
MMELRKCCNHPYLITGAEEKIVSELREVYDPLAPDFHLQALVRSAGKLVLLDKLLPRLKA
GGHKVLIFSQMVRCLDILEDYLIHKRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLL
CTRAGGLGINLTAADTCVIFDSDWNPQNDLQAQARCHRIGQSKAVKVYRLITRNSYEREM
LDKASLKLGLDRAVLQSMSGNKESSVNGIQQFSKKEIEDLLRKGAYAAIMDENDEGSRFC
EEDIDQILQRRATTITIESEGKGSTFSKASFVASENRTDIALDDPEFWQKWAKKADIDMD
SLNRKNTLVIDTPRVRKQTRQFSSLRGEGGDLSDLDSDDDYPPHNSRQSRASRRSDRHSG
GGYGRTDCFRVEKHLLVYGWGRWRDILSHARCKRRLSERDVETICRVILVFCLIHYRGDE
NIKSFIWELITPPENGREPQALLNHSGLSIPVPRGRKGKRVKAQSSFDVQKVEWIRKYNP
DSLLLDDSYRKHLKHQCNKVLLRVRMLYYLKQEVIGEHADSVLSGADARDIDIWLPEMEQ
QDVPSGWWDAEADRCLLIGVYKHGYEMYTTMRADPCLCFVERCGRPNEQDINAEQQAADP
ELGEGGDYDKYSEDPEFKPATRHAKEMYEEGDSVNADGEICVEDRSAPMQVEGPSSGSSD
LCYWPTSSSLTARLRRLITAYQRSYRREQLKIEAAEKGDRRRRRCEQATKLKEIARQERQ
QRWTRREECDFYRVVSTFGVERIKKETDAPEGDEHHMDWNRFRSFARLDKKTDESLTRYF
KCFMSMCRKVCHIRPGRGDESQDMSQSLAPITEERASRTLYRVTLLCRLRERVLPHPSLE
ERLSLAPQTSDLPSWWSIPKHDHELLLAAARHGVSRTELSIFSDPLYSFSQSRLDYLQNQ
QAQAAAQIHAFSQSQDPAGIKEEGLEDESRLLGVEALCPSDSPAMLLSHSDSKVGIQAGW
VWKKSKNNGPSERKLGGGGGGASDSDSDSDSGSSSSSRHSGSSDDSGDSDVEREQAAALK
MCDGDEENSILSLTPSQEGAPPESLTDPLRVDWPKDRILINRIENLCSLVITGHWPSGRR
Download sequence
Identical sequences ENSDARP00000011455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]