SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000014790 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000014790
Domain Number 1 Region: 943-1217
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.32e-71
Family Tandem AAA-ATPase domain 0.0000165
Further Details:      
 
Domain Number 2 Region: 691-941
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.55e-55
Family Tandem AAA-ATPase domain 0.0000591
Further Details:      
 
Domain Number 3 Region: 445-492,519-565
Classification Level Classification E-value
Superfamily Chromo domain-like 3.85e-19
Family Chromo domain 0.012
Further Details:      
 
Domain Number 4 Region: 326-398
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.58e-17
Family PHD domain 0.0021
Further Details:      
 
Domain Number 5 Region: 585-657
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000000000171
Family Chromo domain 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000014790
Domain Number - Region: 162-202
Classification Level Classification E-value
Superfamily HMG-box 0.00106
Family HMG-box 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000014790   Gene: ENSDARG00000063535   Transcript: ENSDART00000005453
Sequence length 1930
Comment pep:known chromosome:Zv9:19:5625090:5682362:-1 gene:ENSDARG00000063535 transcript:ENSDART00000005453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSEDDRDDFEHRSVMQEEDDLEEELSENDAPKVKKKKKAKKSSRESKGSKRNRSRREE
IGISSPEPGEGPDLDDGEEDRSESEGSDYTPGRKKKKRASTAKDKKRNSSAAERNSAASK
RREPEEEEDEDDDDSEPKSSSQLLDTWGMEDIDHIFTEEDYRTLTNYKAFSQFVRPLIAA
KNPKIAVSKMMMVLGAKWREFSTNNPLRGSATSLVAAASVETPPETPTSASAAQISPEST
PAAPVRKAKTKEGKGPNARKKSKPAPKPQEKKVKTKKVAPLKIKLGGFNSKRKRSSSEED
DVDVDSDFDDGSINSVSVSNGSNSRSSRSSAKKKPKKKTKKDEDGDGYETDHQDYCEVCQ
QGGEIILCDTCPRAYHMVCLDPDMEKAPEGTWSCPHCEKMGIQWEAREDASEGEEDNEAG
GEAEEDDHHMEFCRVCKDGGELLCCDSCPSSYHIHCLNPPLPEIPNGEWICPRCTCPSMK
GKVQKILTWRWTEPPPPTPVPRPSDLPTDAPDPTPLAGRPEREFFVKWQNMSYWHCSWVT
ELQLEIHCQVMFRNYQRKNDMDEPPPIDFGGEGEEEKSDKRKKKDPTYARMEEKYYRFGI
KMEWMVIHRILNHSVDKKNNCHYLIKWRDLTYDQATWELEDMDLPDYDTYKLQYWNHREL
MMGDEGKPGKKIKIKGKMRKLDRPPENPVVDPTIKFERQPDYLDTTGGTLHPYQLEGLNW
LRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEM
WAPDMYVVTYVGDKDSRAVIRENEFSFENNAIRGGKKPSKMKKEASVKFHVLLTSYELIT
IDTAVLGSIDWACLVVDEAHRLKNNQSKFFRILNNYPLQHKLLLTGTPLQNNLEELFHLL
NFLTPERFSNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKHMPSKTELIVRV
ELSPMQKKYYKFILTRNFEALNTRGGGNQVSLLNVVMDLKKCCNHPYLFPAAAMEAAKMP
NGMYEGGGLTKSSGKLLLLQKMLRKLKEGGHRVLIFSQMTKMLDLLEDFLENEGYKYERI
DGGITGGMRQEAIDRFNAPGAPQFVFLLSTRAGGLGINLATADTVVIYDSDWNPHNDIQA
FSRAHRIGQNKKVMIYRFVTKASVEERITQVAKKKMMLTHLVVRPGLGSKTGSMSKQELD
DILKFGTEELFKDEGEGENKEGQEDSSVIHYDDKAIDRLLDRNQDATDDTELQSMNEYLS
SFKVAQYVVKDEEEAEEEVQREIIKQEESVDPDYWEKLLRHHYEQQQEDLARNLGKGKRI
RKQVNYNDGSQEDRDWQDDQSDGQSDYSVASEEGDEDFDERSEANSRRPNRKGLRNDKDK
PLPPLLARVSGNIEVLGFNARQRKAFLNAVMRYGMPPQDAFTTQWLVRDLRGKSEREFKA
YVSLFMRHLCEPGADGAESFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGQWSM
PWMMELSENKTTSTAGSHPDSPSKTPTTGTPSDTQPNTPAPDGVPKAEDAGKDADKEKVK
NGDGEKEANENKNSEVIAVPDEDGRAASASEEKEKGKEEKEKTPESSSEAEKADGKQEEK
EEENAKSGDSEEKTDDTDKPKGSEADKETSDAKGEKKDDEPEKMDTTPVTDEKKGQKDEK
DSGKTEEAGKLPNGESAKDSAAGAGIEERKKAKTRFMFNIADGGFTELHSLWQNEERAAT
VTKKTNEIWHRRHDYWLLAGIIQHGYARWQDIQNDVRFAILNEPFKGEINRGNFLEIKNK
FLARRFKLLEQALVIEEQLRRAAYLNMTEDPSHPSMALNTRFSEVECLAESHQHLSKESM
SGNKPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLASRG
PDTQSQQVQQ
Download sequence
Identical sequences F1QWV5
ENSDARP00000014790 XP_005159409.1.45394 ENSDARP00000014790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]