SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000014936 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000014936
Domain Number 1 Region: 1136-1437
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.78e-67
Family Tandem AAA-ATPase domain 0.0000354
Further Details:      
 
Domain Number 2 Region: 861-1134
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.26e-58
Family Tandem AAA-ATPase domain 0.0000631
Further Details:      
 
Domain Number 3 Region: 2597-2682
Classification Level Classification E-value
Superfamily BRK domain-like 1.96e-23
Family BRK domain-like 0.00002
Further Details:      
 
Domain Number 4 Region: 2529-2602
Classification Level Classification E-value
Superfamily BRK domain-like 0.00000000000000196
Family BRK domain-like 0.00046
Further Details:      
 
Domain Number 5 Region: 739-803
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000000000000196
Family Chromo domain 0.015
Further Details:      
 
Domain Number 6 Region: 815-880
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000000000000592
Family Chromo domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000014936   Gene: ENSDARG00000074498   Transcript: ENSDART00000027807
Sequence length 2948
Comment pep:known chromosome:Zv9:7:37825859:37948130:1 gene:ENSDARG00000074498 transcript:ENSDART00000027807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDPIMDFFDDPNIFGGGLDGLVQDDSGFNPGTVSLDDELALGPSLVVDAGSRSSIVQHG
IPYSQPVGHFDTMKAQTSMEQSFPGPDADSNDARTFLAQQQFQGHSLNQVPQTNGIFLHN
SPMWGNHDQKGNNYHQQHQPHQQLHHQQLQHKQFQQQQQFQQHQAQHQQYSHQHLQQRQH
SLNQHPVTNQLQLRHQQIAHQGLPHIGKNYQEHTRFYYEDNILPNNSQQGHHNSLSVEGS
SFHPTVAPGGHSQSKQYIESSMMPMASHQHTGFQATQRVQGFTTGPRMEDNGLTFPVQSP
SATSSFQTDSVTHASSYSTACYALTSQPPPIVNATQSYSSALVSRTTSSTTISSSASNLL
DTVCPFLSTSGLEHNQQVPIMGSPAQQCPISSSKSDQDLFSSSEVFPDGLSSFSADTPFS
MTEQRTCDVPLVTNQRLNSSNAFHSLEEALLGEQHDQRLDDLGEAPDLLEDELLPQLEAL
DQEESSSHSWVNAGVRNSREVKEEVEDVPLVYNAQPPKNTNGPSSQPRVHSPTLKSSSSS
SSSSSSSYMSEKRLQKQKQQQQQQQQQQMESPLSDDKQQKANRIISEAIAKARERGEKNI
PRVMSPDSFPSSSSQHRSHKAGSSKSKSKDKSSKKARIVKSSKPKQKAQIGKIVIKFGKK
KRKKTDSSEELSDDDRPTRRSSKDDDSKRRSNRKVKRKKYEDDGEARISDEEMKVIVKAK
KSSSNKKPAVQLFVENPTEEDAAVVDKIMASRVVKKEVSPGVLVEIEEYFVKYKNYSYLH
CEWATEQQLEKDKRIQQKIKRFKIKQAQKAHFFADIEEDPFNPDYVEVDRVLEVSYCEDK
DSGEPVVYYLVKWCSLPYEDSTWELMEDVDQTKIEEFKKLQAAKPHTNRMERPPASHWKK
LEKSRKYCNENSLRDYQLEGVNWLLFNWYNRRNCILADEMGLGKTIQSITFLEEIYRTGI
KGPFLIIAPLSTIANWEREFRTWTHLNVIVYHGSVVSRQMLQQYEMYCRDSQGRVIRGAY
RFQAVITTFEMILGGCPELNAIDWRCVIIDEAHRLKNKNCKLLEGFKLMSLEHKVLLTGT
PLQNTVEELFSLLHFLEPTRFPSENTFMQEFGDLKTEEQVQKLQAILKPMMLRRLKEDVE
KKLAPKEETIIEVELTNIQKKYYRAILEKNFSFLAKGAGQANVPNLLNTMMELRKCCNHP
YLIKGAEEKIMEDFKEVYSPAAVDFHLQAMIQSAGKLVLIDKLLPKMKAGGHKVLIFSQM
VRCLDILEDYLIQRRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINL
TAADTCIIFDSDWNPQNDLQAQARCHRIGQNKAVKVYRLITRNSYEREMFDRASLKLGLD
KAVLQSMSGRDNSLAGGGQMQQQLSKKEIEDLLRRGAYGAIMDEEDEGNKFCEEDIDQIL
QRRTKTITIESEGRGSTFAKASFVASGNRTDISLDDPNFWDKWAKKAEIDMDTVNGRNSL
VIDTPRVRKQTRPFSSTKDELAELSEGESSGDDKPKLRRPHDRLNSYGRTECFRVEKNLL
VYGWGRWKDILAHGRFKRQLSERDVEWICRALLSYCLVHYRGDDKIKSFMWDLIAPTEDG
RTKELQNHLGLSTPVPRGRKGKKMKTQSSSFDIQKAEWIRKHNPEHMLSDDGYKKHLKHH
CNKVLLRVRMLYYLKQELIGAQCQQVLEGIDASEIEIRVPELDRSEMPAMWWDMLSDKCL
LLGVYKHGYEKYNTIRADPKLCFLDRVGRPDEKAIAAEQRGNDFIDGDVDDPEYKPAPAL
MKDDMEDDASSPGDLVITDAGEGGSMLDGGGGTLSSGSGVYWPSPSALTARLRRLITASQ
RFTKSRQILQIHQTQQAMTPALYPMPPTLTDTFNPKIAAKIERQQRWTRREEADFYRVVS
TFGVVFDPDLGRFDWTKFRAMARLHKKTDESLHKYLCAFIAMCRRVCRLPAIEGDMVDSS
LAIQPITEERASRTLYRVELLRKIREQVLRHPQLYEHLALCQPGPDLPVWWETGSHDRDL
LLGAAKHGVSRTDYHILRDPELCYMAAQRNYSQNKGSTAQAQAPNQTLSLGQCHTPTPLP
TPLQHIQMKEASASPLLNQTELKEEPLSEGEEEAGERELKMETASVRPPTPSGVDEKDDI
LKVGESESRMEAARTKPLTPNSITRKQKKLSKRSRREARRESRSDSDSDGSSSSSSSSSS
SRSSSSSSSSSRSGSSSSSSSSSCSSGSSSSSSSSSSSSEGSDSEEAPKNASVVPGVKGF
DEDSVASLNTTQDDMQDSHVTNGISNPPHPFQGGYMLAASYWPKDRVMINRLDSICQAVL
KGKWPGVRRAYEGNAVASFYTTKLLDNASTLPEDPSDSPQGSKVKKHVADREKEFSVKIN
NEGSLKLTFQKQGLPLKRPLEGEEGPLAQQQYLARLQELQNASDISLADYTKTQNYPQVL
PEQMRLNGVMDGQPIVKRRRGRRKNVEGMDLLFMNRNRPPVMPEQTPAGWSGGVAGMSGP
SGLSTPQGPSTFDTESRVPVISLKDGTRLAGEDAPKRKELDQWLKEHPGFVADVGAFIPT
ANKLQFQDGRPKQKRHRCRNPNKIDINSLTGEERVQIINRRNARKIGGAFAPPLKDLSRF
LQENPEYGVPPEWADVVKQSGYLPESMFDRILTGPIVPEEVSRRGRRPKNAMPKAAMVTG
ASANAALGLNPLLTNGLLAGLDLNSLQALQHNLQSLQSLQLTTGLMGLPHDPSNMAAMFP
MMLSGMTGLPNLLGMSSLIGNPSQEVAGVAPLGDEEEKKKSAGDIPKSSALNLSLDGKAE
RTEAQSSKATTSNQTSASASGHPLALNPLLLSSMLYPGMLLTPGLNLPVANQPQAANTQP
TPALQPAASEAMAPQPGQSEDKDSDEGEEPDEKKDTSGPEGSAKADSSSSESDSSSSSSE
DSDSSDED
Download sequence
Identical sequences XP_021333594.1.45394 XP_021333595.1.45394 ENSDARP00000014936 ENSDARP00000014936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]