SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000015424 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000015424
Domain Number 1 Region: 996-1295
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.32e-66
Family Tandem AAA-ATPase domain 0.0000423
Further Details:      
 
Domain Number 2 Region: 722-994
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.92e-58
Family Tandem AAA-ATPase domain 0.0000325
Further Details:      
 
Domain Number 3 Region: 600-665
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000000000000653
Family Chromo domain 0.026
Further Details:      
 
Domain Number 4 Region: 671-739
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000000216
Family Chromo domain 0.0067
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000015424
Domain Number - Region: 2180-2207
Classification Level Classification E-value
Superfamily BRK domain-like 0.00011
Family BRK domain-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000015424   Gene: ENSDARG00000075543   Transcript: ENSDART00000009942
Sequence length 2221
Comment pep:known chromosome:Zv9:2:37792881:37818491:-1 gene:ENSDARG00000075543 transcript:ENSDART00000009942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPIMDLFDDTPLFNLDSLPEDAFSQGSSDPVEEALKLALGQVDPPTDPIPDPGVPILS
DVVTDPALIPTPVSVPLQNLQTQQLSQIPHEQQTQQITAVTQQAAGQHAPKIVILKGPQG
QTQVLQGVTGATGSPGKVTLARVLTGTPLRPGMAVVSGGTVLNATSPAQGQPQQLQAQIQ
AQTQVALQTQAQTQTPTSPAAAGIRPQSVTLSAVPQQGEAKRITLVLQQPSQGGAAQAGT
VTVGGTAGSGQQGQQPRLVLGSLPGKLVLQGDQLAALAQAKAGQTGAQAKVLTIQLQVQQ
QPNQQGAKLFLQQFQLVSGAANAGGSPQVVQISQGQGGQRLAVPLKLLLQPQSNTVSSAG
GAVSVVKVINTSAAGSTSGTTTTAASSGVRLAKIQEPVRRVETLCKQEKANRIVAEAIAR
AKARGERNIPRVLNQDELPAGQTSADLEGAGGATGAKKKGGGGVGGGGGGSKKKIIPGGG
SKSKSKTKLNTITLVGKKRKRNPSSDHSDVDLSPPVSPRTLEEEMSQKRRSNRQVKRKKY
TEDLDIKITDDEDELDADVDVTTTPMPAVGHVQPLGAELPPELDGDGLPSMQFFVENPSE
EDAAIVDKILSMRVTKKEVCPGQYTNVEEFFVKYKNYSYMHCEWASLEQLERDKRIHQKL
KRFKTKQAQMRNLFQEDEEPFNPDYVEVDRILDESHSVDKDNGEPVVYYLVKWCSLPYED
ATWELKEDVDEGKVEEFRKIESRQPRLKRTPRPAASAWKKLDESTEYKNGNQLREYQLEG
VNWLLFNWYNRQNCILADEMGLGKTIQSIALLSEMFSAGVQSPFMIIAPLSTITNWEREF
SNWTDMNAIVYHGSLASRQMIQQYEMYCKDDKGHLIPGAYKFDALITTFEMILSDCPELR
EISWRCVVIDEAHRLKNRNCKLLDSLKMLEIEHKVLLTGTPLQNTVEELFSLLHFLEPAQ
FPSEIEFLREFGDLKTEEQVQKLQSILKPMMLRRLKEDVEKNLAPKQETIIEVELTDVQK
KYYRAILERNFSFLSMGATQNSNVPNLLNTMMELRKCCNHPYLITGAEEKIVSELREVYD
PLAPDFHLQALVRSAGKLVLLDKLLPRLKAGGHKVLIFSQMVRCLDILEDYLIHKRYLYE
RIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTCVIFDSDWNPQNDL
QAQARCHRIGQSKAVKVYRLITRNSYEREMLDKASLKLGLDRAVLQSMSGNKESSVNGIQ
QFSKKEIEDLLRKGAYAAIMDENDEGSRFCEEDIDQILQRRATTITIESEGKGSTFSKAS
FVASENRTDIALDDPEFWQKWAKKADIDMDSLNRKNTLVIDTPRVRKQTRQFSSLRGEGG
DLSDLDSDDDYPPHNSRQSRASRRSDRHSGGGYGRTDCFRVEKHLLVYGWGRWRDILSHA
RCKRRLSERDVETICRVILVFCLIHYRGDENIKSFIWELITPPENGREPQALLNHSGLSI
PVPRGRKGKRVKAQSSFDVQKVEWIRKYNPDSLLLDDSYRKHLKHQCNKVLLRVRMLYYL
KQEVIGEHADSVLSGADARDIDIWLPEMEQQDVPSGWWDAEADRCLLIGVYKHGYEMYTT
MRADPCLCFVERCGRPNEQDINAEQQAADPELGEGGDYDKYSEDPEFKPATRHAKEMYEE
GDSVNADGEICVEDRSAPMQVEGPSSGSSDLCYWPTSSSLTARLRRLITAYQRSYRREQL
KIEAAEKGDRRRRRCEQATKLKEIARQERQQRWTRREECDFYRVVSTFGVERIKKETDAP
EGDEHHMDWNRFRSFARLDKKTDESLTRYFKCFMSMCRKVCHIRPGRGDESQDMSQSLAP
ITEERASRTLYRVTLLCRLRERVLPHPSLEERLSLAPQTSDLPSWWSIPKHDHELLLAAA
RHGVSRTELSIFSDPLYSFSQSRLDYLQNHKVGIQAGWVWKKSKNNGPSERKLGGGGGGA
SDSDSDSDSGSSSSSRHSGSSDDSGDSDVEREQAAALKMCDGDEENSILSLTPSQEGAPP
ESLTDPLRVDWPKDRILINRIENLCSLVITGHWPSGRRYISDIQLNTVSDEHELGDDLGY
SRVARKINSTLSAEALEGQESEFTVKLLKEEGLKLTFSKQALMPNGEGSARKKRKDHEID
AKCKIVVVVLQLEDAEGVLHAPRRRDLPNWLKENPDYEVEGDMLEVSSSWTEVSNDVSSW
L
Download sequence
Identical sequences ENSDARP00000015424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]