SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000015887 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000015887
Domain Number 1 Region: 85-160
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.09e-32
Family Skp1 dimerisation domain-like 0.00000653
Further Details:      
 
Domain Number 2 Region: 2-70
Classification Level Classification E-value
Superfamily POZ domain 1.23e-25
Family BTB/POZ domain 0.0000378
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000015887   Gene: ENSDARG00000003151   Transcript: ENSDART00000008454
Sequence length 163
Comment pep:known chromosome:Zv9:21:44026863:44034625:-1 gene:ENSDARG00000003151 transcript:ENSDART00000008454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTIKLQSSDGEMFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
Download sequence
Identical sequences Q6PBY8 W5L8P8
7955.ENSDARP00000015887 ENSDARP00000015887 ENSDARP00000015887 NP_957037.1.45394 XP_007241403.1.101067 XP_016151516.1.42290 XP_016393876.1.44103 XP_016393877.1.44103 XP_016393878.1.44103 XP_016410890.1.44103 XP_017560794.1.86671 XP_017560795.1.86671 XP_018921238.1.5815 ENSAMXP00000016210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]