SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000017640 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000017640
Domain Number 1 Region: 16-83
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000051
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000017640   Gene: ENSDARG00000002707   Transcript: ENSDART00000026907
Sequence length 274
Comment pep:known chromosome:Zv9:14:31408114:31410596:-1 gene:ENSDARG00000002707 transcript:ENSDART00000026907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSTPTFNMTKTEGIKRRLKPVIEKKRRDRINHNLDALRDLLFKNTADTRLQNPKLEKAE
ILDLAVQYIKKTIRKTETARNSNQMDCKSTQNQFVISPAGPLYTSDYCRRFKTSEQNEVL
LNLGVSQNLSGSSKTGNKLVSQKGFLLSPPGQNYHQELLLHPESSLYGSSLLRQSTSPSI
SSSSQYSSPPSSPTFTSTSCSPSSSPPCPSTSCAAFPDQLSPLITPLSLQRPVFVPQAIL
PHMTRDLTPPHSPVLALRQDPFPLPNQHAWRPWS
Download sequence
Identical sequences Q6W4T8
ENSDARP00000017640 ENSDARP00000017640 NP_001003886.1.45394 7955.ENSDARP00000017640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]