SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000018393 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000018393
Domain Number 1 Region: 99-149
Classification Level Classification E-value
Superfamily Orange domain-like 2.75e-16
Family Hairy Orange domain 0.0025
Further Details:      
 
Domain Number 2 Region: 25-94
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000144
Family HLH, helix-loop-helix DNA-binding domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000018393   Gene: ENSDARG00000006514   Transcript: ENSDART00000023613
Sequence length 270
Comment pep:novel chromosome:Zv9:6:36329655:36331416:-1 gene:ENSDARG00000006514 transcript:ENSDART00000023613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPADIMEKNSSSPVAATPASMNTTPDKPKTASEHRKSSKPIMEKRRRARINESLGQLKTL
ILDALKKDSSRHSKLEKADILEMTVKHLRNMQRAQMTAALNTDPTVLGKYRAGFSECMNE
VTRFLSTCEGVNTEVRTRLLGHLASCMTQINAMNYPTQHQIPAGPPHPSFSQPMVQIPSA
TQQANVVPLSGVPCKSGSSSNLTSDATKVYGGFQLVPATDGQFAFLIPNAAFAPNGPVIP
VYANNSNTPVPVAVSPGAPSVTSDSVWRPW
Download sequence
Identical sequences Q6PBX3
NP_571154.2.45394 ENSDARP00000018393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]