SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000020784 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000020784
Domain Number 1 Region: 281-474
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.59e-52
Family Ypt/Rab-GAP domain of gyp1p 0.0032
Further Details:      
 
Domain Number 2 Region: 452-572
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.62e-31
Family Ypt/Rab-GAP domain of gyp1p 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000020784   Gene: ENSDARG00000005927   Transcript: ENSDART00000017422
Sequence length 639
Comment pep:known chromosome:Zv9:3:30318065:30337417:-1 gene:ENSDARG00000005927 transcript:ENSDART00000017422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAKPESHKLIFEKEGVYLHTNAKRSNQDTTIPGFIRIVERDGEPALEWSPVEDDGRNAP
AVFYTKKDGEGGEEETKFDPGYEPDWAVISTVKQDRRQEQPPVRETGHWSSFSLPLSELY
SLRRARFSLGRNFLVLTTRGGDPLPPLHFHRGGTRELLKAMQRYIRLAPSPMDGRLFLAY
PHDSGALSQSFDELHLFDDTSADLVSRFIQDPYATTFGGFSKVTNFFRGALRNPESPLNN
RSPQDPHFPHSADEEPGFELITCGAELGPRPEVKRGKPLDNWEQFLDPEGRVTDPQKVKE
LVFRGGIVPYLRKEVWKFLLGFYPWNSTTKEREDILMVKTDEYFRMKVQWKSVSEEQEMR
NSLFRGYRSLIERDVNRTDRHNSFFSGNENPGLTLLHDVLMTYCMYNFDLGYVQGMSDLL
SPLLFVTQNEVESFWCLTGFMDLVHQNFEESQEAMKQQLLQLSLLLRALDPELCDYLDSQ
DSGSLCFCFRWLLIWFKREFSFEDILSLWEVLWTRLPCENFHLLMACSILESQKEELIGS
NHDFNSILKHINELTMKLDLQSVLCGAEAIYLQLTHCKELSPKVQEVLGLRIPSGSSEQS
PDSEACEMDTLLSHSQARGATSCQPFNGHTPQRPPPTYP
Download sequence
Identical sequences F1QXN6
7955.ENSDARP00000020784 XP_005164004.1.45394 ENSDARP00000020784 ENSDARP00000020784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]