SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000022523 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000022523
Domain Number 1 Region: 49-222
Classification Level Classification E-value
Superfamily PR-1-like 6.15e-54
Family PR-1-like 0.00012
Further Details:      
 
Domain Number 2 Region: 299-398
Classification Level Classification E-value
Superfamily LCCL domain 7.72e-29
Family LCCL domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000022523   Gene: ENSDARG00000013293   Transcript: ENSDART00000021469
Sequence length 403
Comment pep:known chromosome:Zv9:2:30094482:30111291:1 gene:ENSDARG00000013293 transcript:ENSDART00000021469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCGHLEDLFSGFVLLVTVQTVVSMVIPNATHLEAILEKYMDKDETWWQSKSRGKRAISQ
SDMQLILDLHNKLRGQVYPPASNMEYMVWDTELERSAEHWAHTCLWEHGPSHLLTRIGQN
LGAHWGRDRPPTFHVQAWYDEVRDFSYPYPQECNPHCPYRCSGPVCTHYTQLVWATSNKI
GCAINVCYNMNVWGMIWAKAVYLVCNYSPPGNWWGHAPYKHGTPCSACPPSYGGGCRNNL
CYKDDGSNYHYTPETEENNYIEPEPEPVRSHDTHYRDETTTPSPNENIERNEVSSTSQMS
QQVACDTRLRDQCKGTTCNRYECPPGCFYNYGKVIGSGHYDMNSSICRAAIHAGVIQSDS
GGYVDVMPVDKRKQHKGSYQNGISSESLQNPPGGKAFRVFAVI
Download sequence
Identical sequences 7955.ENSDARP00000022523 ENSDARP00000022523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]