SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000022655 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000022655
Domain Number 1 Region: 70-137
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.83e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000022655   Gene: ENSDARG00000009702   Transcript: ENSDART00000019446
Sequence length 195
Comment pep:known chromosome:Zv9:7:51172738:51174183:1 gene:ENSDARG00000009702 transcript:ENSDART00000019446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEATVVATTQLTQDSFYQPFSESLEKQDRECKVLKRQRSSSPELLRCKRRLTFNGLGYTI
PQQQPMAVARRNERERNRVKQVNMGFQTLRQHVPNGAANKKMSKVETLRSAVEYIRALQQ
LLDEHDAVSAVLQCGVPSPSVSNAYSAGPESPHSAYSSDEGSYEHLSSEEQELLDFTTWF
DRYESGASMATKDWC
Download sequence
Identical sequences Q90260
NP_571306.1.45394 ENSDARP00000022655 7955.ENSDARP00000022655 ENSDARP00000022655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]