SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000024532 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000024532
Domain Number 1 Region: 24-185
Classification Level Classification E-value
Superfamily RUN domain-like 1.19e-44
Family RUN domain 0.0000545
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000024532
Domain Number - Region: 237-297
Classification Level Classification E-value
Superfamily Tropomyosin 0.0654
Family Tropomyosin 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000024532   Gene: ENSDARG00000007245   Transcript: ENSDART00000002393
Sequence length 430
Comment pep:known_by_projection chromosome:Zv9:3:21108949:21128253:-1 gene:ENSDARG00000007245 transcript:ENSDART00000002393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCLQTAMAMGLTSKKTSSRNIGVERKNLITVCRFSVKTLLEKYTAEPIDDSSEEFINFAA
ILEHILSHRFKGPGGWFSSDGQRSFWDYIRLACSKVYNNCISSIESIENISTSRAKGRAW
IRVALMEKRLSEYVAIALRDTRTTRRFYDDGAVMLREEATVLTGMLIGLSAIDFSFCLKG
EVLDGKTPAVIDYTPYLKFTQSYDYLSDEEDRRSVDSSASDESVAEHPYIPLVTDEETWS
NKCRKMEQRFKIVNAQKGYLEELVRLRESQLKNVETENKRLDAKLEELQVQSQQEKKELE
AIILERMFCSTGIIPCEPSHLVKGLSIPLINQWATAQATNNQGNVKLFRRRSFHSLDLSA
DLSLNSDSQKEDGNQNGDTVWSAAKDNTPSMLGLCGSLASLPSCKSLASLKSSEYLVNIS
TEPSPALSPS
Download sequence
Identical sequences ENSDARP00000024532 ENSDARP00000024532 7955.ENSDARP00000024532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]