SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000025803 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000025803
Domain Number 1 Region: 292-473
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.44e-36
Family CRAL/TRIO domain 0.00016
Further Details:      
 
Domain Number 2 Region: 482-648
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 2.48e-18
Family Supernatant protein factor (SPF), C-terminal domain 0.0082
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000025803
Domain Number - Region: 196-249
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.000785
Family CRAL/TRIO N-terminal domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000025803   Gene: ENSDARG00000019301   Transcript: ENSDART00000009973
Sequence length 675
Comment pep:known chromosome:Zv9:3:60950852:60972191:-1 gene:ENSDARG00000019301 transcript:ENSDART00000009973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AYDRRFPTCPLIPMFVKSDIINESHSEDGAELFIERRCTVDVEAPRLLKRIAGVDYMYFI
QKNSLNRRERTLHIEAYNESFSSRVNVYEHCCYTVHPENEDWTCFEQSASMDIKSFFGFE
STAEKIAMKQYATSIKKGKEIIEFHLKQLEEEGITHMPRWVPPTAPQLIPVSSAKPIPAC
TSRAHLGSTDVVPGSPDDKLDADYISRYLGTLTPFQESCLIRLRQWLQETHKGKLPKNQF
KIRLCRFRDVARCRIRHALCQALMLKHRVKIMWLSIQMQGNQAAKEVINGPGWHYHDKKG
APLHLLWLEITRIVVKSLVLFNFDRHVLSINEEGLRRCEENTKIFGKPISCWTCLVDLEG
LNMRHLWRPGIKALLRMIEVVGANYPETLGRLLILRAPRVFPVLWTLVSPFIDENTRKKF
LIYAGNDYQGPGGLVDYINKDCIPDFLGGDSMCDIPEGGLVPKSLYRTAEELENEEVKLW
NETIYKSASVLKGAPHEVLIEITDVSSVITWDFDVCKGDMIFNIYHSRRAPQPVKKEGLS
AHNLACPAGNNVQFIDRSWMLGQDYSMVETALTCREGESVQGSHVTRWPGFYILQWRLYS
TPSCSSSSRPRVDDVLASLQVSSHRCKVMYFTEVLQSADFRGSMSSLESSHSGFSLLSAS
TTSSNHSHTASTISR
Download sequence
Identical sequences ENSDARP00000025803 ENSDARP00000025803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]