SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000027441 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000027441
Domain Number 1 Region: 77-137
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.7e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000027441   Gene: ENSDARG00000011635   Transcript: ENSDART00000011858
Sequence length 200
Comment pep:known_by_projection chromosome:Zv9:16:33700820:33706327:1 gene:ENSDARG00000011635 transcript:ENSDART00000011858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFAMVRPTPGHYLCSEINMHSEDDDNGSEGSGSEDKSFRTSSHGYGSFKLGVRKKRYSC
RPLAIPTELCTPITEVRQRNTANARERERTNSVNTAFTALRTLIPTEPADRKLSKIETLR
LASSYISHLGNVLLVGEECGDGQPCLRSSGSLFHHHHNVSKSSTPSPDSENSQPRQICTF
CLSNQRRLNKDRERKTVLRS
Download sequence
Identical sequences E7F361
ENSDARP00000027441 7955.ENSDARP00000027441 XP_021328670.1.45394 XP_696212.3.45394 ENSDARP00000027441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]